KEGG   Equus przewalskii (Przewalski's horse): 103561118Help
Entry
103561118         CDS       T04644                                 

Gene name
SPI1
Definition
(RefSeq) Spi-1 proto-oncogene
  KO
K09438  transcription factor PU.1
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz04380  Osteoclast differentiation
epz05166  Human T-cell leukemia virus 1 infection
epz05200  Pathways in cancer
epz05202  Transcriptional misregulation in cancer
epz05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:epz00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103561118 (SPI1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103561118 (SPI1)
   05202 Transcriptional misregulation in cancer
    103561118 (SPI1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    103561118 (SPI1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103561118 (SPI1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:epz03000]
    103561118 (SPI1)
Transcription factors [BR:epz03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    103561118 (SPI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ets
Motif
Other DBs
NCBI-GeneID: 103561118
NCBI-ProteinID: XP_008533768
LinkDB All DBs
Position
Un
AA seq 271 aa AA seqDB search
MLQACKMEGFPLIPPQPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPPHVH
SEFETFAENHFTELQSVQPPQLQQLYRHMELEQMHVLDTSGQPSHAGLGTQVPCLSRVYL
PYPSLSPAQPSSDEEEAERQSPPLEVSDGETDGLEPGPGLLHGETGSKKKIRLYQFLLDL
LRSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKGNRKKMTYQKMARALRNYGKTG
EVKKVKKKLTYQFSGEVLGRGGLAERRHPPH
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgttacaggcgtgcaaaatggaagggtttcccctcatcccccctcagccatcagaagac
ctggttccctacgacacggatctgtaccaacgccaaacgcatgagtattacccgtatctc
agcagtgatggagaaagccacagtgaccattactgggacttccacccgccccacgtgcac
agcgaattcgagaccttcgccgagaaccacttcaccgagctgcagagcgtgcagcccccc
cagctgcagcagctctaccgccacatggagctggaacagatgcacgtgctcgacacctcc
gggcagcccagccacgccggccttggcacccaggtcccctgcctatcccgggtgtacctc
ccgtacccctccctgtccccagcccagcccagctcggatgaggaggaggctgagcggcag
agccccccactggaggtgtctgatggggagaccgatggcctggagccggggcctggcctc
ctgcatggcgaaacaggcagcaagaagaagatccgcctgtaccagttcctgctcgacctg
ctgcgcagcggcgacatgaaggacagcatctggtgggtggacaaggacaagggcaccttc
cagttctcgtccaagcacaaggaggcgctggcccaccgctggggcatccagaagggcaac
cgcaagaagatgacctaccagaagatggcccgcgcgctgcgcaactatggcaagacgggc
gaggtcaagaaggtcaagaagaagctcacctaccagttcagcggggaggtgctgggccgc
gggggcctggcggagcggcgccacccgccccactga

DBGET integrated database retrieval system