KEGG   Equus przewalskii (Przewalski's horse): 103561568
Entry
103561568         CDS       T04644                                 

Gene name
WDR62
Definition
(RefSeq) WD repeat domain 62
  KO
K21762  WD repeat-containing protein 62
Organism
epz  Equus przewalskii (Przewalski's horse)
Brite
KEGG Orthology (KO) [BR:epz00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:epz03036]
    103561568 (WDR62)
Chromosome and associated proteins [BR:epz03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    103561568 (WDR62)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A DUF5046
Other DBs
NCBI-GeneID: 103561568
NCBI-ProteinID: XP_008534475
LinkDB
Position
Un
AA seq 1501 aa
MTRSSVSLEKVLGITAQNSNGLTCDPGTGHVAYLAGCVVVILNPKENKQQHIFNTARKSL
SALAFSPDGKYIVTGENGHRPAVRIWDVDEKSQVAEMLGHKYGVACVAFSPNMKHIVSMG
YQHDMVLNVWDWKKGILVASNKVSCRVIALSFSEDSSYFVTVGNRHVRFWFLEVSTEAKV
TGTVPLVGRSGILGELHNNVFCGVACGRGRMAGNAFCVSYSGLLCQFNEKRVLEKWINLK
VSLSSCLCVSQELIFCGCTDGIVRIFQAHSLHYLANLPKPHYLGVDVAQGLEPSFLFHRK
AEAVYPDTVALTFDPIHQWLSCVYKDHSIYIWDVKDINKVGKMWSELFHSSYVWNVEVYP
EFEDQRACLPSGSFLTCSSDNTIRFWNMDSSPDSHWQKNIFSNTLLKVVYVENDIQHLQD
MSHFPDRGSENGTPLDVKAGVRVMQVSPDGQHLASGDRSGNLRIHELHFMDELVKVEAHD
AEVLCLEYSKPETGLTLLASASRDRLIHVLNVEKNYNLEQTLDDHSSSITAIKFAGTRDI
QMISCGADKSIYFRSAQQASDGLHFVRTHHVAEKTTLYDMDIDITQKYVAVACQDRNVRV
YNTVNGKQKKCYKGSQGDEGSLLKVHVDPSGTFLATSCSDKSISVIDFYSGECIAKMFGH
SEIVTSMKFTYDCRHLITVSGDSCVFIWHLGPELTNCMKQHLLEIDRREQQRQETKDGMW
SSQPRQETYVSMPSETCSLSPGEQTEDELEDECEPEELLKTPSKESLDPDPQCLLTNGKL
PLWAKRLLGDDDDVVDGSAFHARRSYQPHGRWAERADQEPLKTILDARDLDCYFTPMKPE
SLEDSLLDTVEPQSPAGLLSEPESPRDDGCGHPSFLPLQRESSEASELIIYSPEAEVTVT
GTDSEDCAKEGMREPGDQQGDCYLQVPSIGLKHQSPPEDSGESEANLECSFATIHSSPPQ
PDPDPRFDVPMPPTPGCPGTAEELSQPEVPSISNGSLPQTPEQEKFLRHHFETLTDAPPE
ELFHGSLRDVQASEAXXXASEAEDSFNPRLSISAQFLSRLQNTSRFSHTCPPQLPLHLGK
PPEVKRSDFRGSQPRAEPPRVDAGCTSPGRTSVLSVGMAEEPLEPLEAWCPLTPCLTGLP
PCVPSSSVLPTDGKPLTPTALPTPGLAQEVCTPSTRSYLQTTASSRAKMSRSISVEDRES
PVLAELPRPLRRPSSMGELASLGQDLQAVSTAAPSSDSEAQEPALPSWGNHEARASLKLT
LSNICDGLLLPPPLLEPPTTCVWSQEPVATQPDVMAATASFLAHSPMDGSTLRLHNSAFL
PRLPAPEPLNTPAHPNKPPLPEASPGAPGSITSLLERGQSWGPWRHHLPPGAHSWPWGHG
TWWSTRLQRIDTLTGGDAQTKSIRKVLTLDLYHLVVSSDQVSAEQRQARTELASTFHWIH
CQLEANDWLLGTDVAPDQALPSPGPPSPPTLCPLASPDLHALLEHYSELLVQAVRRKARG
D
NT seq 4506 nt   +upstreamnt  +downstreamnt
atgactagaagctcagtgtcactcgagaaggtgctcggcatcacagctcagaacagcaat
ggcctaacctgtgaccccggcacaggccacgtggcctacctggcaggctgtgtggtggtg
attttgaaccccaaggagaacaagcagcagcacatttttaatactgccaggaagtctctg
agtgctctggccttctcccctgatgggaagtacatagtgacgggggagaacgggcacagg
cctgccgtgcgcatctgggacgtggatgagaagagtcaggtggcagagatgctgggccac
aaatacggcgtggcctgtgtggccttctcccccaacatgaagcacatcgtgtccatgggc
taccagcacgatatggtgctcaacgtctgggactggaagaaaggcattttggtggcttcc
aacaaggtctcatgcagagttatcgccctctccttctccgaggacagcagctattttgtc
accgttgggaaccggcatgtgaggttctggttcttggaagtctccactgaggcaaaggtg
acgggcacggtgcccctcgtggggcgctcaggcatcctgggtgagctgcacaacaacgtc
ttctgtggtgtggcttgtggccggggccggatggcaggcaatgccttctgtgtgtcctac
tcgggcctcctctgccagttcaacgagaagagggtactagagaagtggatcaacctaaag
gtctccttgtcttcctgcctctgtgtcagccaggagctcatcttctgcggctgcacagat
gggatagtccgcatcttccaggcccacagcctgcactacctcgccaacctgcccaagcca
cactacctcggggtggacgtggcgcagggcctggagcccagcttcctcttccacaggaag
gcagaagcagtctacccagatacagtggcgctgaccttcgaccccatccaccagtggctg
tcctgcgtgtataaagaccacagcatctacatctgggatgtcaaagacatcaacaaagta
ggcaagatgtggtcggagctcttccacagctcctacgtctggaatgtggaggtgtatcct
gagtttgaagatcagagagcttgtctgccatcaggatcttttctgacttgttcctcagac
aacaccatccgcttctggaacatggatagcagccctgactctcactggcagaaaaacatc
ttcagtaataccctgctgaaggtagtgtatgtggagaacgacatccagcacctgcaggac
atgtcccacttcccagaccgagggagcgagaatgggacacctctggacgtgaaggccggg
gtgcgagtcatgcaggtcagtcctgacggccagcacttggcttcaggcgaccgaagtgga
aatctgaggatccacgagctgcacttcatggacgagctggtcaaggtggaggcccacgac
gccgaggtgctgtgcctggagtactccaagcccgagacggggctgaccttgctggcctca
gccagtcgggaccgactgatccacgtgctgaacgtggagaagaactacaacctggagcag
accctggacgaccactcctcctccatcacagccatcaagttcgctggcaccagagacatc
cagatgatcagctgtggggctgacaagagcatctactttcgcagtgcccagcaggcctcg
gatggactacactttgtccgtacccaccacgtagcagagaagaccaccttgtatgacatg
gacattgacatcacccagaagtatgtggctgtggcctgccaagaccgcaatgtaagagtc
tacaacacggtgaacgggaagcagaagaagtgctataagggctcccagggtgacgagggc
tccctgctgaaggtccacgtggacccctcaggcaccttcctggccacaagctgctctgac
aaaagcatctccgtgatcgacttttactcgggcgagtgcattgccaagatgtttggccat
tcagaaatcgtcaccagcatgaagttcacctatgactgtcgtcacttgatcacagtgtct
ggagacagctgcgtgttcatctggcacctgggcccggagctcaccaactgcatgaagcag
cacttgctggagatcgaccgccgggagcagcagcggcaggaaacgaaggacgggatgtgg
agcagccagcccaggcaggagacatatgtatccatgcccagcgagacatgctccctaagc
cctggagaacagacggaggatgagctggaagacgagtgtgaacctgaagagttgctgaag
acaccgtccaaggagagcttggatccagatcctcagtgcctgctgaccaacggcaagctg
ccactctgggcaaagcggctgctaggagatgacgatgatgtggtggatggctcagccttc
catgccaggcgcagctaccagccgcatggccgctgggcagagcgggctgaccaggagccc
ctcaagaccatcctggatgcccgggacctggattgctactttacccccatgaagcccgag
agcctggaggactcccttctggatacagtggagccacagagcccggcgggcctgctgagc
gagcccgagagtccccgggacgatggctgtgggcatccctccttcctgcccctacagagg
gagtcctctgaggccagcgagctcatcatctactccccagaggcggaggtgacggtcaca
gggacagacagcgaggactgtgcgaaggaggggatgagggagcccggagaccagcaaggc
gactgctacctccaggtcccctccatcggcttgaagcatcagagcccacctgaggactca
ggggagtcagaggccaacttggagtgcagcttcgccaccatccactcctcccctccacaa
ccggacccagaccctcgatttgacgtgccaatgcccccaacaccaggatgcccaggtacc
gcagaagagttgtcccagcccgaagtgccaagcatttccaacggctccctgccccagacc
cctgagcaggagaaattcctccgccaccacttcgagacacttactgacgccccccctgag
gagctcttccacggatccctgagggacgtgcaggcctctgaggctnnnnnnnnngcctct
gaggctgaggactccttcaatccccggctgagcatctcggcccagttcctctcccgcctc
cagaacacatccaggttcagccacacctgccctccccagctgcccctgcaccttgggaag
cccccagaggtcaaacggtcagacttcagagggagccagcccagagcagagcccccaaga
gtggatgctggttgcacctccccgggcaggaccagtgttctctctgtggggatggctgag
gagcccctcgagcccctggaggcctggtgcccactgaccccctgcctcacaggcctgcca
ccatgtgtcccctcctcctcagtgctgcccacagacgggaagcctctgacgcccacagcc
ctacccactccaggcctggctcaggaggtctgcaccccctccacccgctcctacctgcag
accactgccagctcccgtgccaagatgtcacgtagcatctctgtcgaggacagggagagc
cctgtcctggctgagctgcccagacccctccgcagaccctcgtccatgggggagctggcc
tccctgggccaggatctccaggctgtcagcacagcagcacccagttctgacagcgaggcc
caagagcctgccctgccctcctggggcaaccatgaggcccgagccagcctgaaactgacc
ctgtcgaacatatgtgatgggctcttgctgcccccacccctgctggagcctcctaccacg
tgcgtctggtcccaggaacctgtagccacccagcctgatgtcatggccgcaacagccagc
ttcctggcccatagccccatggatgggagcaccctgaggctccacaactccgcctttctc
ccaaggcttccagcccctgagcccctcaacacccctgcccaccccaacaagcccccgctt
ccagaggccagtcctggggcccctggcagcatcacctccctcctggagcgaggccagtcc
tggggcccctggcggcatcacctccctcctggagcccactcctggccctgggggcatggg
acatggtggtcaacaagactacagagaattgacaccttaactgggggagatgcccagact
aaatctataaggaaagtgctaactctggacctttaccacctggtggtctccagtgaccag
gtgagcgctgagcagcggcaggcccggactgagctggcctccaccttccactggatccac
tgccagttagaggccaatgactggctgcttggaactgatgtggccccagaccaggccctg
cctagcccagggcccccttccccccctacattgtgcccccttgccagccccgatttgcac
gccctgctggaacactactcggagctgctggtgcaggctgtgcggaggaaggcccggggg
gactga

DBGET integrated database retrieval system