KEGG   Equus przewalskii (Przewalski's horse): 103562880Help
Entry
103562880         CDS       T04644                                 

Gene name
KMT5C, SUV420H2
Definition
(RefSeq) lysine methyltransferase 5C
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:epz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    103562880 (KMT5C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:epz03036]
    103562880 (KMT5C)
Enzymes [BR:epz01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     103562880 (KMT5C)
Chromosome and associated proteins [BR:epz03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     103562880 (KMT5C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 103562880
NCBI-ProteinID: XP_008536261
LinkDB All DBs
Position
Un
AA seq 327 aa AA seqDB search
MERVRAEGRTGGGPELRPWSQCWVWVHTPSPGFSSQEVVRTCLLCGCEDEFVPADGNAAC
VKVLRDIEPGDEVTCFYGDGFFGEKNEHCECYTCERKGEGAFRLRPREPVPPRPLDKYEL
RETKRRLQQGLDSSGRQGLLGPRACAHLSLLRRDPFCAACQPLRPQPCGSRLDAVPLWLQ
WLPQPQLRVRPRRRRRPQPRRALAPPVLRAARVSLHRWGGCGPRCCLRAEALVALGQGPR
ARWAPQQDWHWARRYGLPYVARVDLSRMAPAPPATTVPAPVRTPGPSPGSGPIPKQALAF
APFSPPKRLRLVVSHGSINLDVNGDRP
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcgtgagagctgagggccggacgggagggggtccagagctcagaccctggagt
cagtgctgggtttgggtccacacccccagccctggtttctcgtctcaggaggtggtgaga
acttgcctcctgtgcggttgtgaagatgagtttgtgcccgcagatgggaatgcagcctgc
gtgaaggtgctccgggacatcgagccaggggacgaggtgacctgcttctacggtgacggc
ttctttggtgaaaagaatgagcactgtgaatgctacacctgcgagaggaaaggcgaagga
gctttccgactgcggccccgggagcctgtgcctccgcgacccctggacaagtacgagctc
cgggagaccaagcggcggctgcagcaaggcctggacagcagtggccggcagggcctgctg
ggcccacgcgcctgcgcccacctgtctctgctgcgccgggaccccttctgcgccgcctgt
cagcccctgcgcccccagccctgcggctcccgcctggacgccgtgcccctctggctccag
tggctgcctcagccacagctccgagtgcgcccccggaggcgccgacgcccccagccccgg
cgggccctggcaccccctgttctccgcgctgcccgtgtctccctgcaccggtggggaggc
tgcggcccccgctgttgcctccgggcggaagccctggtggccctgggccaaggcccccgt
gcccgttgggccccccagcaggactggcactgggcccggcgctacgggctgccttatgtg
gcgcgcgtggacctgagccgcatggccccggccccacctgccactactgtccccgcccct
gtcaggaccccaggccccagccccggctccggccccatccccaagcaagcccttgccttc
gctcccttctccccacccaagcgcctgcggctggtggtcagccacggctccatcaacctg
gatgtcaatggtgacaggccatga

DBGET integrated database retrieval system