KEGG   Equus przewalskii (Przewalski's horse): 103563105Help
Entry
103563105         CDS       T04644                                 

Gene name
GABRQ
Definition
(RefSeq) gamma-aminobutyric acid type A receptor theta subunit
  KO
K05192  gamma-aminobutyric acid receptor subunit theta
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz04080  Neuroactive ligand-receptor interaction
epz04723  Retrograde endocannabinoid signaling
epz04727  GABAergic synapse
epz05032  Morphine addiction
epz05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:epz00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103563105 (GABRQ)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    103563105 (GABRQ)
   04723 Retrograde endocannabinoid signaling
    103563105 (GABRQ)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    103563105 (GABRQ)
   05033 Nicotine addiction
    103563105 (GABRQ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:epz04040]
    103563105 (GABRQ)
Ion channels [BR:epz04040]
 Ligand-gated channels
  GABA-A
   103563105 (GABRQ)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Motif
Other DBs
NCBI-GeneID: 103563105
NCBI-ProteinID: XP_008536563
LinkDB All DBs
Position
Un
AA seq 633 aa AA seqDB search
MGIRGMLRAAVLLLLIRTWLAESNDPSSTPKFHFELSSTVPEVVLNLFNCKNCANEAVVH
KILDRVLSRYDARLRPNFGGAPVPVGVSIYVSSIEEISEMTMDYTITMIFHQTWKDPRLA
YYETNLTLTLDYRMLEKLWVPDCYFLNSKDAFVHDVTVENRMFQLHPDGTVRYGIRLTTT
AACSLNLQKFPLDKQTCKLEVESYGYTVEDIVLYWEGNGNAIQGTEKLQIPQFSFLGKTM
TSKEVFFFTGSYVRLILRFLVQREVTSYLVQIYWPTILTTVVSWISFWMNYESSAARVTV
GLTSMLVLNAINSHLRDKLPQVSCIKAIDIYMVVCLFFVFLSLLEYVHINYLFYSRRPRR
HXXXXXRRARRVMARYHYQEMKCQDDQVNIEDENGSPPSRPEEAHLGSPESLGSLTSLSV
QAPLATSESLSSLSSLSVQALVATGESLSDLPATSEQPLHSYGIRFNGFKIDDSIIPTEI
RNRAEAHGRAESRDPEDPEESSSSDENHSHGPSGRHLLVHGRRYVREVRSNLDEIRTVPD
DIKVESGCLDLKHDVASTWSLNVDDFMGFEQDKDSNSESDDSCPPSPGCSFSEGFSSKLF
HPDYVPKVDKWSRILFPLAFVVFNIVYWAYHII
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgggcatccgagggatgcttcgagctgccgtgctcctgctgctcatcaggacctggctc
gcggagagcaacgaccccagttctaccccgaaattccactttgagctctcctccactgtg
cccgaagtcgtcctgaacctcttcaactgcaaaaattgtgcaaatgaagctgtggttcac
aagattttggacagggtgctgtcgagatatgatgcccgtctgagaccaaattttggaggt
gcccctgtgcctgtgggagtatctatttatgtctccagtattgaagaaatctcagaaatg
actatggactatacaatcacgatgatttttcatcagacctggaaagatccacgtttagca
tactatgagaccaacctgaccctgaccctggactatcggatgcttgagaagttgtgggtc
cccgactgctactttctaaatagcaaggatgctttcgtgcatgacgtgactgtggaaaat
cgcatgtttcagcttcacccagatggaacggtgcggtatggcatccgactcaccaccaca
gcagcttgttccctgaatctacaaaaattccctctggacaagcagacctgcaagctggag
gtggagagctatggctacacggttgaagacattgtattatactgggaaggcaatgggaat
gccatccaggggactgagaagctgcagatccctcagttcagcttcctggggaagacaatg
actagcaaagaggtgtttttcttcacaggttcctatgtgcgcctgatactgaggttcctg
gtccagagggaagtcaccagctatcttgtgcagatctattggcctaccatcctcaccact
gttgtctcttggatatcgttttggatgaactatgaatcctctgcagccagggtgacagtt
ggtctgacttcaatgctcgtcctgaatgccatcaactcacatctgcgggataaactcccc
caagtttcttgtatcaaggctattgacatctatatggttgtatgcctcttcttcgtgttc
ctgtccttgctggaatacgtccacatcaactatcttttctacagccgaagaccccgacgc
cattannnnnnnnnnngcaggagagcccgaagagtcatggcccgctatcactaccaggaa
atgaagtgtcaggatgaccaggttaacatagaagatgaaaatggctctcctccctccaga
ccagaggaggcccacctgggaagcccagaaagccttgggtctttgacctccctctcagtg
caggccccactggccacctccgaaagcctcagctcactgtcttctctctcagtccaggcc
ttggtggctactggagaaagcctgagtgatctcccggccacctcagagcagcccctgcac
agctatggcattcgctttaatggtttcaagattgatgacagtattattcctaccgaaatc
cgcaaccgtgctgaagcccatggccgtgctgagtcccgtgacccagaagaccctgaggag
agctccagctcagatgagaaccacagccatggccctagtgggaggcatctgcttgtccac
ggccggaggtatgtgcgagaagtacgctccaaccttgatgagatccgtaccgtgcctgat
gacatcaaagttgagagtggctgccttgacctcaagcatgatgttgccagtacctggagc
cttaatgttgatgatttcatgggctttgagcaagacaaggacagtaactccgagtctgat
gacagttgccccccgagccctgggtgctccttcagtgaagggttctcctccaagctcttt
caccctgactatgtccctaaggtagacaagtggtcccggatcctcttccctcttgctttt
gtggtattcaacattgtttactgggcataccatatcatttag

DBGET integrated database retrieval system