KEGG   Equus przewalskii (Przewalski's horse): 103563297
Entry
103563297         CDS       T04644                                 

Gene name
ATF6B
Definition
(RefSeq) activating transcription factor 6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz04022  cGMP-PKG signaling pathway
epz04141  Protein processing in endoplasmic reticulum
epz04151  PI3K-Akt signaling pathway
epz04211  Longevity regulating pathway
epz04261  Adrenergic signaling in cardiomyocytes
epz04668  TNF signaling pathway
epz04728  Dopaminergic synapse
epz04911  Insulin secretion
epz04915  Estrogen signaling pathway
epz04918  Thyroid hormone synthesis
epz04925  Aldosterone synthesis and secretion
epz04926  Relaxin signaling pathway
epz04927  Cortisol synthesis and secretion
epz04928  Parathyroid hormone synthesis, secretion and action
epz04934  Cushing syndrome
epz04935  Growth hormone synthesis, secretion and action
epz05020  Prion disease
epz05030  Cocaine addiction
epz05031  Amphetamine addiction
epz05034  Alcoholism
epz05161  Hepatitis B
epz05163  Human cytomegalovirus infection
epz05166  Human T-cell leukemia virus 1 infection
epz05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:epz00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103563297 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    103563297 (ATF6B)
   04022 cGMP-PKG signaling pathway
    103563297 (ATF6B)
   04151 PI3K-Akt signaling pathway
    103563297 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    103563297 (ATF6B)
   04915 Estrogen signaling pathway
    103563297 (ATF6B)
   04926 Relaxin signaling pathway
    103563297 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    103563297 (ATF6B)
   04918 Thyroid hormone synthesis
    103563297 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    103563297 (ATF6B)
   04925 Aldosterone synthesis and secretion
    103563297 (ATF6B)
   04927 Cortisol synthesis and secretion
    103563297 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103563297 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    103563297 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    103563297 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    103563297 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    103563297 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    103563297 (ATF6B)
   05031 Amphetamine addiction
    103563297 (ATF6B)
   05034 Alcoholism
    103563297 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103563297 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103563297 (ATF6B)
   05161 Hepatitis B
    103563297 (ATF6B)
   05163 Human cytomegalovirus infection
    103563297 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:epz03000]
    103563297 (ATF6B)
Transcription factors [BR:epz03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    103563297 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf DUF4407 GIT_CC ZapB YabA Docking
Other DBs
NCBI-GeneID: 103563297
NCBI-ProteinID: XP_008536830
LinkDB
Position
Un
AA seq 703 aa
MAELMLLSEIADPTRFFTDNLLSPEDWGLRNSTLYTGLDEVAEEQTQLFRCPEQDVPFGS
SSLDVGMDVSPPEPPWDSVPIFPDLQVKSEPSSPCSSSSFTSESSRLSTEPSSQGPGVGE
VLVVKTESLAPPLCLLGDDPTSPFETIQINVGPTSDDPSDVQTKIEPVSPSSSINSEASL
LSAESPNQAFIGEEVLEVKTESLSPQGYLLRDVPGPPLGAVQISMGPSPDGSSGKALPTR
KPPLQPKPVVITTVPMPPRAVPASTTVLLQPLVQPPPVSPVVLIQGAIRVQPEGPAPPAP
RPERKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQGLEARLQAV
LADNQQLRRENAALRRRLEGLLAENSELKLGSGNRKVVCIMVFLLFIAFNFGPVSISEPP
SAPVSPQMNGEEPRPRRHLLEFSAQEPVHGVEALQGSTQSHEEPQPSPASRPSFRNLTAF
PGGAKELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKIPQRAQEKQKS
QLRKKSPPVKAVPTQPPGPPERDSVGQLQLYRHPDRSQPEFLDAIDRREDTFYVVSFRRD
HLLLPAISHNKTSRPKMSLVMPAMAPNETLSGRGAPGDYEEMMQIECEVMDTRVIHIKTS
TVPPSLRKQTSSTPGNATGGPLPASAAGQAHQATHRPLYLNHP
NT seq 2112 nt   +upstreamnt  +downstreamnt
atggcggagctgatgctcctcagcgagattgcggacccgacccgttttttcaccgacaac
ttgctgagcccggaggactggggtctgcggaatagcaccttgtacactggtctggatgaa
gtggccgaggaacagacgcagctcttccgttgcccggagcaggatgtcccgtttggcagc
agctccctggacgtgggaatggatgtcagccccccggaacccccctgggactccgtgcct
atcttcccagatcttcaggtgaagtctgagccatcttccccctgctcttcctcctccttc
acctctgaatcatcgcgtctttctacggagccctccagccagggtcctggtgtaggggag
gtgctcgttgtgaagacagagtccttggcacctccactctgcctcctaggagatgaccca
acgtccccatttgaaaccatccagatcaatgtgggccccacctctgatgatccctcagat
gtccagaccaagatagagcctgtctctccgtcttcttccatcaactctgaggcttccctg
ctctcagcagagtcccccaaccaggctttcataggagaggaggtactggaagtgaagaca
gagtctctgtcccctcaagggtatctcctgcgggatgtcccaggccccccacttggagct
gtccagatcagcatgggcccgtcccccgatggctcctcaggcaaagccctgcccacgcgg
aagccaccactgcagcccaaacccgtggtgataaccactgtcccaatgccacccagagct
gtgcctgccagcaccactgtccttttgcagccccttgtccagccacccccagtgtcccca
gttgtcctcatccaaggtgctattcgagtccagcctgaggggccagccccccctgcacca
aggcctgagaggaagagcattgttccagctcctatgcctgggaactcctgtccacctgaa
gtggatgcaaagctgctgaagcggcagcagcgaatgatcaagaaccgggaatcagcctgc
cagtccaggaggaagaagaaagagtatctgcaggggctggaggctcgactgcaggctgtg
ctggccgacaaccaacagctccgccgggagaatgctgccctccggcggcggctggagggc
ctgctggctgagaacagcgagctcaagttagggtctggaaacaggaaggtggtctgcatc
atggtcttccttctcttcattgccttcaacttcgggcctgtcagcatcagtgagcctcct
tcggctcccgtgtctcctcagatgaacggagaggagcctcgacctcggagacacttgctg
gagttctcagcacaagagccggttcatggagttgaggccctccagggctccactcagagc
catgaggagccccagcccagccccgcaagcaggccaagcttcaggaacctgacagccttc
cctgggggtgccaaggagctgctgctgagagacctggaccagctcttcctctcctctgat
tgccggcacttcaaccgaaccgagtccctgaggcttgctgacgagctgagcggctgggtc
cagcgccaccagagaggccggcggaagatcccccagagggcccaggagaaacagaagtct
cagctacggaagaagtcgcctccagttaaggcagtccccacccaaccccccgggccccca
gaaagggattctgtgggccagctgcagctgtatcgccacccagaccgttcacagccagag
ttcctggatgcaattgaccgacgggaagacacattttatgttgtctccttccgaagggac
cacttgctgctcccagccatcagccacaacaagacctctcggcccaagatgtccctggtg
atgcctgccatggcgcccaacgagaccctgtcaggccggggggccccaggggactatgag
gagatgatgcagatcgagtgtgaggtcatggacaccagggtgattcacatcaagacctcc
acagtgcccccctcgctccgaaaacagacgtcctcaaccccaggcaatgccacaggtggc
cccttgccagcttctgcagctggccaggcccaccaggccacccatcggcccctctacctc
aatcatccctga

DBGET integrated database retrieval system