KEGG   Equus przewalskii (Przewalski's horse): 103563367
Entry
103563367         CDS       T04644                                 

Gene name
IL4
Definition
(RefSeq) interleukin 4
  KO
K05430  interleukin 4
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz04060  Cytokine-cytokine receptor interaction
epz04151  PI3K-Akt signaling pathway
epz04630  JAK-STAT signaling pathway
epz04640  Hematopoietic cell lineage
epz04657  IL-17 signaling pathway
epz04658  Th1 and Th2 cell differentiation
epz04659  Th17 cell differentiation
epz04660  T cell receptor signaling pathway
epz04664  Fc epsilon RI signaling pathway
epz04672  Intestinal immune network for IgA production
epz05140  Leishmaniasis
epz05200  Pathways in cancer
epz05310  Asthma
epz05320  Autoimmune thyroid disease
epz05321  Inflammatory bowel disease
epz05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:epz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103563367 (IL4)
   04151 PI3K-Akt signaling pathway
    103563367 (IL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103563367 (IL4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103563367 (IL4)
   04660 T cell receptor signaling pathway
    103563367 (IL4)
   04658 Th1 and Th2 cell differentiation
    103563367 (IL4)
   04659 Th17 cell differentiation
    103563367 (IL4)
   04657 IL-17 signaling pathway
    103563367 (IL4)
   04664 Fc epsilon RI signaling pathway
    103563367 (IL4)
   04672 Intestinal immune network for IgA production
    103563367 (IL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103563367 (IL4)
  09163 Immune disease
   05310 Asthma
    103563367 (IL4)
   05320 Autoimmune thyroid disease
    103563367 (IL4)
   05321 Inflammatory bowel disease
    103563367 (IL4)
   05330 Allograft rejection
    103563367 (IL4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    103563367 (IL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:epz04052]
    103563367 (IL4)
   00536 Glycosaminoglycan binding proteins [BR:epz00536]
    103563367 (IL4)
Cytokines and growth factors [BR:epz04052]
 Cytokines
  Interleukins
   103563367 (IL4)
Glycosaminoglycan binding proteins [BR:epz00536]
 Heparan sulfate / Haparin
  Cytokines
   103563367 (IL4)
SSDB
Motif
Pfam: IL4 Tugs
Other DBs
NCBI-GeneID: 103563367
NCBI-ProteinID: XP_008536927
LinkDB
Position
Un
AA seq 139 aa
MGLISQLIPALVCLLACTSNFIQGCKYDITLQEIIKTLNNLTDGKGKNSCMELTVADAFA
GPKNTDGKEICRAAKVLQQLYKRHDRSLIKECLSGLDRNLKGMANGTCCTVNEAKKSTLK
DFLERLKTIMKEKYSKCQS
NT seq 420 nt   +upstreamnt  +downstreamnt
atgggtctcatctcccaactgattccagctctggtctgcttactagcatgtaccagcaac
ttcatccagggatgcaaatacgacatcaccttacaagagatcatcaaaacgctgaacaac
ctcacagatggaaagggcaagaattcgtgcatggagctgactgtagcggatgcctttgct
ggcccgaagaacacagatggaaaggaaatctgcagggctgcaaaggtgcttcaacagctc
tataaaagacatgacaggtccttgatcaaagaatgcctgagcggactggacaggaacctc
aagggcatggcaaacgggacctgctgtactgtgaatgaagccaagaagagcacattgaaa
gactttttggaaaggctaaagacgatcatgaaagagaaatactcaaagtgtcaaagctga

DBGET integrated database retrieval system