KEGG   Equus przewalskii (Przewalski's horse): 103564091Help
Entry
103564091         CDS       T04644                                 

Definition
(RefSeq) trypsin-like
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz04080  Neuroactive ligand-receptor interaction
epz04972  Pancreatic secretion
epz04974  Protein digestion and absorption
epz05164  Influenza A
Brite
KEGG Orthology (KO) [BR:epz00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103564091
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    103564091
   04974 Protein digestion and absorption
    103564091
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05164 Influenza A
    103564091
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:epz01002]
    103564091
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:epz04147]
    103564091
Enzymes [BR:epz01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     103564091
Peptidases [BR:epz01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   103564091
Exosome [BR:epz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103564091
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Trypsin_2
Motif
Other DBs
NCBI-GeneID: 103564091
NCBI-ProteinID: XP_008537864
LinkDB All DBs
Position
Un
AA seq 246 aa AA seqDB search
MKTFIFLALLGASVASSTDDDDKIVGGYTCQANSVPYQVSLNVGYHICGGSLISNQWVVS
AAHCYQSRFQVRLGEHNIAVTEGNEQFINSAKVIRHPSYNSRTYDNDILLIKLSSPASIN
SKVSAISLPASFPAAGTQCLISGWGNTLSSGSNYPNLLQCLNAPILSDSSCRSSYPNQIT
SNMFCAGFLEGGKDSCQGDSGGPVACSGVLQGIVSWGYGCAQRNKPGVYTKVYNYVNWIR
QTIAAN
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaagacttttatcttccttgctctcctgggagcctctgttgcttcctccactgacgat
gatgacaagattgtcgggggctacacctgtcaggcgaattccgtgccctaccaggtgtct
ctgaacgtcggctaccacatctgcggtggctcactcatcagtaaccagtgggttgtgtct
gctgctcactgctaccagtcccgattccaggtgcgtctgggagaacacaacattgcagtc
actgagggcaatgagcaattcattaattcagccaaggtcatccgccaccccagctacaat
tcaaggacctacgataatgacatcctgctgattaaactgagctccccggcctccatcaac
tctaaagtgtctgcgatctctctgccagcatctttcccagctgctggtacccagtgcctc
atctctggctggggaaacaccctcagcagtggctccaactaccctaacctcctgcagtgt
ctgaatgctcccatcctctccgatagttcttgccgcagttcctacccaaaccagatcacc
agcaacatgttctgtgcaggcttcctagagggtggaaaggactcctgccagggtgactct
ggtggccctgtggcttgcagtggagtgctccagggcattgtctcctggggctatggctgt
gctcagagaaacaagcctggtgtctacaccaaggtctacaactacgtgaactggattagg
cagaccatcgctgccaactaa

DBGET integrated database retrieval system