KEGG   Equus przewalskii (Przewalski's horse): 103564535
Entry
103564535         CDS       T04644                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin dependent kinase inhibitor 1A
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz01522  Endocrine resistance
epz01524  Platinum drug resistance
epz04012  ErbB signaling pathway
epz04066  HIF-1 signaling pathway
epz04068  FoxO signaling pathway
epz04110  Cell cycle
epz04115  p53 signaling pathway
epz04151  PI3K-Akt signaling pathway
epz04218  Cellular senescence
epz04630  JAK-STAT signaling pathway
epz04921  Oxytocin signaling pathway
epz04928  Parathyroid hormone synthesis, secretion and action
epz04934  Cushing syndrome
epz05160  Hepatitis C
epz05161  Hepatitis B
epz05163  Human cytomegalovirus infection
epz05165  Human papillomavirus infection
epz05166  Human T-cell leukemia virus 1 infection
epz05167  Kaposi sarcoma-associated herpesvirus infection
epz05169  Epstein-Barr virus infection
epz05200  Pathways in cancer
epz05202  Transcriptional misregulation in cancer
epz05203  Viral carcinogenesis
epz05205  Proteoglycans in cancer
epz05206  MicroRNAs in cancer
epz05210  Colorectal cancer
epz05211  Renal cell carcinoma
epz05212  Pancreatic cancer
epz05213  Endometrial cancer
epz05214  Glioma
epz05215  Prostate cancer
epz05216  Thyroid cancer
epz05217  Basal cell carcinoma
epz05218  Melanoma
epz05219  Bladder cancer
epz05220  Chronic myeloid leukemia
epz05222  Small cell lung cancer
epz05223  Non-small cell lung cancer
epz05224  Breast cancer
epz05225  Hepatocellular carcinoma
epz05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:epz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103564535 (CDKN1A)
   04630 JAK-STAT signaling pathway
    103564535 (CDKN1A)
   04066 HIF-1 signaling pathway
    103564535 (CDKN1A)
   04068 FoxO signaling pathway
    103564535 (CDKN1A)
   04151 PI3K-Akt signaling pathway
    103564535 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103564535 (CDKN1A)
   04115 p53 signaling pathway
    103564535 (CDKN1A)
   04218 Cellular senescence
    103564535 (CDKN1A)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    103564535 (CDKN1A)
   04928 Parathyroid hormone synthesis, secretion and action
    103564535 (CDKN1A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103564535 (CDKN1A)
   05202 Transcriptional misregulation in cancer
    103564535 (CDKN1A)
   05206 MicroRNAs in cancer
    103564535 (CDKN1A)
   05205 Proteoglycans in cancer
    103564535 (CDKN1A)
   05203 Viral carcinogenesis
    103564535 (CDKN1A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103564535 (CDKN1A)
   05212 Pancreatic cancer
    103564535 (CDKN1A)
   05225 Hepatocellular carcinoma
    103564535 (CDKN1A)
   05226 Gastric cancer
    103564535 (CDKN1A)
   05214 Glioma
    103564535 (CDKN1A)
   05216 Thyroid cancer
    103564535 (CDKN1A)
   05220 Chronic myeloid leukemia
    103564535 (CDKN1A)
   05217 Basal cell carcinoma
    103564535 (CDKN1A)
   05218 Melanoma
    103564535 (CDKN1A)
   05211 Renal cell carcinoma
    103564535 (CDKN1A)
   05219 Bladder cancer
    103564535 (CDKN1A)
   05215 Prostate cancer
    103564535 (CDKN1A)
   05213 Endometrial cancer
    103564535 (CDKN1A)
   05224 Breast cancer
    103564535 (CDKN1A)
   05222 Small cell lung cancer
    103564535 (CDKN1A)
   05223 Non-small cell lung cancer
    103564535 (CDKN1A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103564535 (CDKN1A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103564535 (CDKN1A)
   05161 Hepatitis B
    103564535 (CDKN1A)
   05160 Hepatitis C
    103564535 (CDKN1A)
   05163 Human cytomegalovirus infection
    103564535 (CDKN1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103564535 (CDKN1A)
   05169 Epstein-Barr virus infection
    103564535 (CDKN1A)
   05165 Human papillomavirus infection
    103564535 (CDKN1A)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    103564535 (CDKN1A)
   01522 Endocrine resistance
    103564535 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 103564535
NCBI-ProteinID: XP_008538573
LinkDB
Position
Un
AA seq 164 aa
MSEPARDARPIPRGSKACRRLFGPVDGEQLRRDCDALMASCAQEARERWNFDFVTETPLE
GDFAWERVRGLGLPKLYLSPGPRGGRDDLRGGKRPSTSPALLQGTAEEDHVDLSLSCTLL
PHPPERPEGSPGEPGTSQGRKRRQTIMTDFYHSKRRRIFSKRKP
NT seq 495 nt   +upstreamnt  +downstreamnt
atgtcggagccggccagggatgctcgtccgatcccgcgtggcagcaaggcctgccgccgc
ctcttcggcccggtggacggcgagcagctgcgccgagactgtgacgcgctgatggccagc
tgcgcacaggaggcccgggagcgatggaacttcgattttgtcaccgagacaccgctggag
ggcgacttcgcctgggagcgcgtgcggggcctcggcctgcccaagctctacctgtccccg
gggccccgggggggccgggacgacctgagagggggcaagcggcccagcacgtcgcctgcc
ctgctgcaggggacagccgaggaggaccacgtggacctgtcgctgtcctgtaccctcctg
cctcacccccctgagcggcctgaggggtccccgggggagcctggcacctctcagggccga
aaacggcggcagaccatcatgacagatttctatcactccaaacgccgccggatcttctcc
aagaggaagccctaa

DBGET integrated database retrieval system