KEGG   Equus przewalskii (Przewalski's horse): 103564709
Entry
103564709         CDS       T04644                                 

Gene name
PTGDR
Definition
(RefSeq) prostaglandin D2 receptor
  KO
K04332  prostaglandin D2 receptor
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:epz00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103564709 (PTGDR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:epz04030]
    103564709 (PTGDR)
G protein-coupled receptors [BR:epz04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    103564709 (PTGDR)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 103564709
NCBI-ProteinID: XP_008538826
LinkDB
Position
Un
AA seq 390 aa
MRPLLYRCHNTTAVEKGNSATMSGVLFSAGLLGNLLALGLLARSGLGSCPPRPPPSVFYV
LVSGLTVTDLLGKSLVSPFVLAAYAQNRSLWGLAPASGSSLCQAFAFFMSFFGLASTLQL
LAMALECWLSLGHPFFYRRHITLRRGALVAPAVGAFCLAFCALPFAGFGSFVQYCPGTWC
FIQMAHEERSLSVLGYSALYAGLMALLVLAIVLCNLSAMRNLYTMHRRLQQRPRPCARDR
TEPGAGAREAAPQPLEELDHLLLLALMTALFTVCSLPLIGPGNSSLQPHGRWDSHQDRDG
LPGVPHPTGYQYRAYRGAFRPVLEENGTTGEAEDLRALRFLSVISIADPWIFIIFRTAVF
RMFFHKIFIRPLMYRNWHSNSCQTNTESSL
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgaggccgttgttgtaccgctgccacaacaccaccgcggtggagaagggcaactcggcg
acgatgagcggggtgctcttcagcgcaggcctcctgggcaacctcctggccctcgggctg
ctggcgcgctcggggctggggtcgtgcccgccgcgcccgccgccctccgtcttctacgtg
ctggtgagcggcctgacggtcaccgacttgctgggcaagtccctcgtgagccccttcgtg
ctggccgcctacgcgcagaaccggagcctgtgggggctggcgcccgcgtcgggcagctcg
ctgtgccaagccttcgctttcttcatgtccttcttcgggctggcctcgaccctgcagctc
ctggccatggccctggagtgctggctctccctggggcaccctttcttctaccgacggcac
atcaccctgcgccggggtgcgctggtggcgccggccgtgggcgctttctgcctggccttc
tgcgcgctgccctttgcgggcttcgggagcttcgtgcagtactgccccggcacctggtgc
ttcatccagatggcccacgaggagcggtcgctgtcggtgctgggctactcagctctctac
gccggcctcatggctctgcttgtcctcgccattgtgctgtgcaacctgagcgccatgcgc
aacctctacacgatgcaccggcggctgcagcagcgcccgcgcccctgcgcccgggaccgc
acggagcccggcgccggcgcgcgagaggcggccccgcagcccttggaggagctggaccac
ctcctgctgctggccctcatgaccgcgctcttcaccgtgtgctccctgcctttaatcggc
cctgggaactccagcctgcagccgcacggcaggtgggacagccaccaggaccgagacggg
ctcccgggagtgccccatcccacgggataccagtaccgtgcttaccgtggagcgtttaga
cctgtcctggaggagaacgggaccacgggggaagccgaagacctccgagctctgcgcttc
ctgtccgtcatctccatcgcggacccttggattttcatcattttcagaacagcggtattt
cggatgttttttcacaagattttcattaggcctcttatgtatagaaattggcacagcaat
tcctgccaaactaacacggaatccagtctgtga

DBGET integrated database retrieval system