KEGG   Equus przewalskii (Przewalski's horse): 103565599Help
Entry
103565599         CDS       T04644                                 

Gene name
GSR
Definition
(RefSeq) glutathione-disulfide reductase
  KO
K00383  glutathione reductase (NADPH) [EC:1.8.1.7]
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz00480  Glutathione metabolism
epz01100  Metabolic pathways
epz04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:epz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    103565599 (GSR)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    103565599 (GSR)
Enzymes [BR:epz01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.7  glutathione-disulfide reductase
     103565599 (GSR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 FAD_oxidored AlaDh_PNT_C FAD_binding_2 GIDA HI0933_like NAD_binding_8 K_oxygenase FAD_binding_3 DAO
Motif
Other DBs
NCBI-GeneID: 103565599
NCBI-ProteinID: XP_008539927
LinkDB All DBs
Position
Un
AA seq 476 aa AA seqDB search
MEEPQPQGPPPAAGAVASYDYLVIGGGSGGLASARRAAELGARAAVVESHKLGGTCVNVG
CVPKKVMWNTAVHSEFIHDHVDYGFQSCESKFNWRVIKEKRDAYVSRLNTVYQNNLTKSH
IEIIRGHAAFTSDPRPTVEVSGKKYTAPHILIATGGMPSRPQESEIPGASLGITSDGFFE
LEELPRRSVIVGAGYIAVEIAGILSALGSKTSLMIRHDKVLRNFDSMISSNCTEELENAG
IEVLKYSQVKEVKKTSSGLDVCMITSVPGRKPTLTMIPDVDCLLWAIGRDPNSRDLNLNA
LGIQTDDKGHILVDEFQNTSVKGVYAVGDVCGKALLTPVAIAAGRKLAHRLFECKEDSKL
DYDNIPTVVFSHPPIGTVGLTEDEAIYKYGKENVKTYSTSFTPMYHAVTKRKTKCVMKMV
CANKEEKVVGIHMQGIGCDEMLQGFAVAVKMGATKADFDNTVAIHPTSAEELVTLR
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggaggagccgcagccgcagggcccgccgcccgccgccggcgccgtggcctcctacgac
tacctggtgatcgggggcggctcgggcgggctggccagcgcgcgccgggcggcagagctg
ggcgccagggccgccgtggtggagagccacaagctgggcggcacttgcgtgaatgtcgga
tgtgtacccaaaaaggttatgtggaacacagctgtccactctgaattcattcacgatcat
gttgactatggttttcaaagttgcgagagtaaatttaattggcgtgttataaaggaaaag
cgagatgcctatgtgagccgtctgaacacggtctatcaaaataatctaaccaagtcccat
atagaaatcatccgtggccatgcggcattcacgtctgatcccaggcccacggtagaggtc
agtgggaagaaatacactgctccacacatcctgattgccacaggtggcatgccctcacgt
cctcaggagagcgagatccccggtgccagcctaggaataaccagtgatggattctttgaa
ttggaagaattgcctcgccgcagtgtcattgttggtgcgggttacattgctgtggagata
gctgggatcctttcagctctgggttctaagacatcgctaatgatacggcatgataaggta
cttagaaattttgattcaatgatcagttcaaactgcactgaagagctggagaatgctggc
atagaggtcctgaagtactcacaggtcaaagaagttaaaaagacttcctcaggcctggat
gtctgcatgattacttcagttcccggtaggaaacccaccttgaccatgattccagatgtt
gactgcctgctctgggccattgggcgggacccaaattccagggacctgaatttaaacgca
ctggggatccaaactgatgacaaaggtcatatcctagtagatgagttccagaataccagt
gtcaaaggtgtctacgcagtgggggacgtgtgtggaaaagctcttctcactccagttgca
atagctgctggccgaaagcttgcccatagactttttgaatgcaaagaagattcgaaatta
gactatgacaacatccccacggtggtcttcagccacccccctattgggacagtgggcctc
acggaagatgaggccatttataaatatggaaaggaaaatgtgaagacctattcgacctcc
tttaccccaatgtatcatgcagttaccaaaaggaaaacaaaatgtgtgatgaaaatggtt
tgtgccaacaaagaggaaaaggtggttgggatccatatgcaaggaattgggtgtgatgaa
atgctgcagggttttgctgtggcagtgaaaatgggagccacaaaagccgactttgataat
acggttgctattcaccctacctctgcagaagaactggtcacacttcgttga

DBGET integrated database retrieval system