KEGG   Equus przewalskii (Przewalski's horse): 103565953Help
Entry
103565953         CDS       T04644                                 

Gene name
PRKACA
Definition
(RefSeq) protein kinase cAMP-activated catalytic subunit alpha
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz01522  Endocrine resistance
epz04010  MAPK signaling pathway
epz04014  Ras signaling pathway
epz04020  Calcium signaling pathway
epz04024  cAMP signaling pathway
epz04062  Chemokine signaling pathway
epz04114  Oocyte meiosis
epz04140  Autophagy - animal
epz04211  Longevity regulating pathway
epz04213  Longevity regulating pathway - multiple species
epz04261  Adrenergic signaling in cardiomyocytes
epz04270  Vascular smooth muscle contraction
epz04310  Wnt signaling pathway
epz04340  Hedgehog signaling pathway
epz04371  Apelin signaling pathway
epz04530  Tight junction
epz04540  Gap junction
epz04611  Platelet activation
epz04713  Circadian entrainment
epz04714  Thermogenesis
epz04720  Long-term potentiation
epz04723  Retrograde endocannabinoid signaling
epz04724  Glutamatergic synapse
epz04725  Cholinergic synapse
epz04726  Serotonergic synapse
epz04727  GABAergic synapse
epz04728  Dopaminergic synapse
epz04740  Olfactory transduction
epz04742  Taste transduction
epz04750  Inflammatory mediator regulation of TRP channels
epz04910  Insulin signaling pathway
epz04911  Insulin secretion
epz04912  GnRH signaling pathway
epz04913  Ovarian steroidogenesis
epz04914  Progesterone-mediated oocyte maturation
epz04915  Estrogen signaling pathway
epz04916  Melanogenesis
epz04918  Thyroid hormone synthesis
epz04919  Thyroid hormone signaling pathway
epz04921  Oxytocin signaling pathway
epz04922  Glucagon signaling pathway
epz04923  Regulation of lipolysis in adipocytes
epz04924  Renin secretion
epz04925  Aldosterone synthesis and secretion
epz04926  Relaxin signaling pathway
epz04927  Cortisol synthesis and secretion
epz04928  Parathyroid hormone synthesis, secretion and action
epz04934  Cushing syndrome
epz04935  Growth hormone synthesis, secretion and action
epz04961  Endocrine and other factor-regulated calcium reabsorption
epz04962  Vasopressin-regulated water reabsorption
epz04970  Salivary secretion
epz04971  Gastric acid secretion
epz04976  Bile secretion
epz05012  Parkinson disease
epz05020  Prion diseases
epz05030  Cocaine addiction
epz05031  Amphetamine addiction
epz05032  Morphine addiction
epz05034  Alcoholism
epz05146  Amoebiasis
epz05163  Human cytomegalovirus infection
epz05165  Human papillomavirus infection
epz05166  Human T-cell leukemia virus 1 infection
epz05200  Pathways in cancer
epz05203  Viral carcinogenesis
epz05205  Proteoglycans in cancer
epz05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:epz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    103565953 (PRKACA)
   04010 MAPK signaling pathway
    103565953 (PRKACA)
   04310 Wnt signaling pathway
    103565953 (PRKACA)
   04340 Hedgehog signaling pathway
    103565953 (PRKACA)
   04371 Apelin signaling pathway
    103565953 (PRKACA)
   04020 Calcium signaling pathway
    103565953 (PRKACA)
   04024 cAMP signaling pathway
    103565953 (PRKACA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103565953 (PRKACA)
  09143 Cell growth and death
   04114 Oocyte meiosis
    103565953 (PRKACA)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    103565953 (PRKACA)
   04540 Gap junction
    103565953 (PRKACA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103565953 (PRKACA)
   04062 Chemokine signaling pathway
    103565953 (PRKACA)
  09152 Endocrine system
   04911 Insulin secretion
    103565953 (PRKACA)
   04910 Insulin signaling pathway
    103565953 (PRKACA)
   04922 Glucagon signaling pathway
    103565953 (PRKACA)
   04923 Regulation of lipolysis in adipocytes
    103565953 (PRKACA)
   04912 GnRH signaling pathway
    103565953 (PRKACA)
   04913 Ovarian steroidogenesis
    103565953 (PRKACA)
   04915 Estrogen signaling pathway
    103565953 (PRKACA)
   04914 Progesterone-mediated oocyte maturation
    103565953 (PRKACA)
   04921 Oxytocin signaling pathway
    103565953 (PRKACA)
   04926 Relaxin signaling pathway
    103565953 (PRKACA)
   04935 Growth hormone synthesis, secretion and action
    103565953 (PRKACA)
   04918 Thyroid hormone synthesis
    103565953 (PRKACA)
   04919 Thyroid hormone signaling pathway
    103565953 (PRKACA)
   04928 Parathyroid hormone synthesis, secretion and action
    103565953 (PRKACA)
   04916 Melanogenesis
    103565953 (PRKACA)
   04924 Renin secretion
    103565953 (PRKACA)
   04925 Aldosterone synthesis and secretion
    103565953 (PRKACA)
   04927 Cortisol synthesis and secretion
    103565953 (PRKACA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103565953 (PRKACA)
   04270 Vascular smooth muscle contraction
    103565953 (PRKACA)
  09154 Digestive system
   04970 Salivary secretion
    103565953 (PRKACA)
   04971 Gastric acid secretion
    103565953 (PRKACA)
   04976 Bile secretion
    103565953 (PRKACA)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    103565953 (PRKACA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    103565953 (PRKACA)
  09156 Nervous system
   04724 Glutamatergic synapse
    103565953 (PRKACA)
   04727 GABAergic synapse
    103565953 (PRKACA)
   04725 Cholinergic synapse
    103565953 (PRKACA)
   04728 Dopaminergic synapse
    103565953 (PRKACA)
   04726 Serotonergic synapse
    103565953 (PRKACA)
   04720 Long-term potentiation
    103565953 (PRKACA)
   04723 Retrograde endocannabinoid signaling
    103565953 (PRKACA)
  09157 Sensory system
   04740 Olfactory transduction
    103565953 (PRKACA)
   04742 Taste transduction
    103565953 (PRKACA)
   04750 Inflammatory mediator regulation of TRP channels
    103565953 (PRKACA)
  09149 Aging
   04211 Longevity regulating pathway
    103565953 (PRKACA)
   04213 Longevity regulating pathway - multiple species
    103565953 (PRKACA)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103565953 (PRKACA)
   04714 Thermogenesis
    103565953 (PRKACA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103565953 (PRKACA)
   05205 Proteoglycans in cancer
    103565953 (PRKACA)
   05203 Viral carcinogenesis
    103565953 (PRKACA)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    103565953 (PRKACA)
   05020 Prion diseases
    103565953 (PRKACA)
  09165 Substance dependence
   05030 Cocaine addiction
    103565953 (PRKACA)
   05031 Amphetamine addiction
    103565953 (PRKACA)
   05032 Morphine addiction
    103565953 (PRKACA)
   05034 Alcoholism
    103565953 (PRKACA)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    103565953 (PRKACA)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103565953 (PRKACA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103565953 (PRKACA)
   05163 Human cytomegalovirus infection
    103565953 (PRKACA)
   05165 Human papillomavirus infection
    103565953 (PRKACA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103565953 (PRKACA)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103565953 (PRKACA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:epz01001]
    103565953 (PRKACA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:epz03019]
    103565953 (PRKACA)
   03036 Chromosome and associated proteins [BR:epz03036]
    103565953 (PRKACA)
Enzymes [BR:epz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     103565953 (PRKACA)
Protein kinases [BR:epz01001]
 Serine/threonine kinases: AGC group
  PKA family
   103565953 (PRKACA)
Messenger RNA biogenesis [BR:epz03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     103565953 (PRKACA)
Chromosome and associated proteins [BR:epz03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    103565953 (PRKACA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 103565953
NCBI-ProteinID: XP_008540378
LinkDB All DBs
Position
Un
AA seq 359 aa AA seqDB search
MGPDHPIPLHPPLHPLPEEAGSRVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGT
GSFGRVMLVKHKETGNHFAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFK
DNSNLYMIMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPEN
LLIDQHGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEM
AAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDI
KNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgggcccagatcaccccatcccactccaccccccactgcaccctctgccagaagaggca
ggaagcagagtgaaagagttcttagctaaagccaaagaagattttcttaaaaaatgggaa
aatcctgctcagaatacagcccatttggatcagtttgaacgaatcaagacccttggcacg
ggctccttcgggcgggtgatgctcgtgaagcacaaggagacggggaaccacttcgccatg
aagatcctcgacaaacagaaggtggtgaagctgaaacagatcgagcacaccctgaacgaa
aagcgcatcttgcaagccgtcaacttcccgttcctcgtcaaactcgagttctccttcaag
gacaactcgaatctgtacatgatcatggagtacgtgcctggcggggagatgttctcacac
ctgcggcggatcggaaggttcagtgagccccatgcccgcttctatgcggcccagatcgtg
ctgaccttcgagtacctgcactcgctcgacctcatctaccgggacctgaagccggagaac
ctgctcatcgaccagcacggctacatccaggtgacagacttcggtttcgccaagcgcgtg
aaaggccgcacctggaccttgtgtgggacccccgagtacctggccccggaaatcatcctg
agcaaaggctacaacaaggctgtggactggtgggccctgggggttctcatctacgagatg
gccgctggctacccacccttctttgccgaccagcccatccagatctacgagaagattgtc
tccgggaaggtgcggttcccgtcccacttcagctctgacctgaaggacctgctgcggaac
ctcctgcaggtggacctcaccaagcgcttcgggaacctcaagaatggggtcaatgacatc
aagaaccacaagtggtttgccacgactgactggatcgccatctaccagaggaaggtggaa
gctcccttcataccaaagtttaaaggccctggggacacgagtaactttgacgactatgag
gaggaagagatccgagtctccatcaatgagaagtgtggcaaggagttctctgagttttag

DBGET integrated database retrieval system