KEGG   Equus przewalskii (Przewalski's horse): 103566169Help
Entry
103566169         CDS       T04644                                 

Gene name
CASKIN1
Definition
(RefSeq) CASK interacting protein 1
  KO
K21952  CASK-interacting protein
Organism
epz  Equus przewalskii (Przewalski's horse)
Brite
KEGG Orthology (KO) [BR:epz00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:epz04131]
    103566169 (CASKIN1)
Membrane trafficking [BR:epz04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    103566169 (CASKIN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_5 Ank_4 SAM_1 Ank SAM_2 Ank_3 Caskin1-CID Caskin-Pro-rich SH3_2 SH3_1 SH3_9 NCD1
Motif
Other DBs
NCBI-GeneID: 103566169
NCBI-ProteinID: XP_008540694
LinkDB All DBs
Position
Un
AA seq 914 aa AA seqDB search
MGKEQELVQAVKAEDVGTAQRLLQRPRPGKAKLLGSTKKINVNFQDPDGFSALHHAALNG
NTELITLLLEAQAAVDIKDNKGMRPLHYAAWQGRKEPMKLVLKAGSAVNIPSDEGHIPLH
LAAQHGHYDVSEMLLQHQSNPCMVDNSGKTPLDLACEFGRVGVVQLLLSSNMCAALLEPR
PGDTTDPNGTSPLHLAAKNGHIDIIRLLLQAGIDINRQTKSGTALHEAALCGKTEVVRLL
LDNGINAHVRNTYSQTALDIVHQFTTSQASKEIKQLLREASAALQVRATKDYCNNYDLTS
LNVKAGDIITVLEQHPDGRWKGCIHDNRTGNDRVGYFPSSLGEAIVKRAGSRAGAEPGPP
QGGGSSGSSAPSEEIWVLRKPFAGGDRSGSLSSVAGGRSSGGHTLHAGSEGVKVXXXVLS
QKSVSESSPGDSPVKPPEGSTGVARSQPPVAHAGQVYGEQPPKKLEPASEGKSAEAVSQW
LATFQLQLYAPNFISAGYDLPTISRMTPEDLTAIGVTKPGHRKKITAEISGLNIPDWLPE
HKPANLAMWLSMIGLAQYYKVLVDNGYENIDFITDITWEDLQEIGITKLGHQKKLMLAVR
KLAELQKAEYAKYEGGPLRRKAPQSLEVMAIESPPAPEPAPADCQSPKMTTFQDSELSGE
LQAAMTGPAEGAAATAATAEKPSNHLPPTPRASMRQEPSLGGRARHMSSSQELLGDGPPG
PGSPMSRSQEYLLDDGPAPGTPPKEARPSRHGHSVKRASVPPVPGKPRQVLPPGASHFTP
PQTPTKARPASPQALGGPHGPAPATAKVKPTPQLLPPTERPMSPRSLPQSPTHRGFAYVL
PQPVEGEAGPAAPGPVPVPTLFLPPEADVEPERPKKRAHSLNRYAASDSEPERDELLVLA
AGGPYATVQRRVGR
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
atggggaaggagcaggagctggtgcaggcggtgaaggcggaggacgtggggaccgcgcag
aggctgctgcagaggccgcggcccgggaaggccaagctcctgggctccaccaagaagatc
aatgtcaacttccaggacccagatggcttctctgccctgcaccacgcggcactgaatggc
aacacggaattgatcaccctgctgctggaggcccaggctgctgtggacatcaaggacaac
aaaggcatgcggccactgcactacgcagcctggcagggccggaaggagcccatgaagctg
gtgctgaaagcgggctcagcagtgaacatcccctccgatgagggccacatccctctgcac
ctggcagcccagcatggtcactacgatgtgtccgagatgctgctccagcaccaatccaac
ccatgcatggtggacaactcggggaagactcccctagacctggcctgtgagttcggtcgc
gtcggggtggtccagctgctcctgagcagcaacatgtgtgcggccctgctggaaccccgg
cccggtgacaccaccgaccccaatggcaccagccccctgcacctggcagccaagaatggc
cacattgacatcatcagactcctcctccaagctggcattgacattaaccgccagaccaag
tccggcacggccctgcacgaggctgcactctgtgggaagacagaagtggttcggctgctg
ctggacaacgggatcaatgcccacgtgagaaacacctacagccagacggccctggacatt
gtgcaccagttcaccacatcccaggccagcaaagagatcaagcagctgctgcgagaggcc
tcggctgcactgcaggtccgggcaaccaaggattattgcaacaattacgacctgaccagc
ctcaatgtgaaagctggggacatcatcacagtccttgagcagcatccagatggccggtgg
aagggctgtatccatgacaaccggacaggcaacgaccgagtgggctatttcccgtcttcc
ctgggcgaggccattgtcaaacgagcaggttcccgagcaggcgccgaaccaggcccaccc
cagggaggcggctcgtcggggtcgtctgcaccctccgaggagatctgggtgctaaggaag
ccttttgcaggtggggaccgcagcggcagcttgagcagtgtggctggtggccggagcagt
gggggccacaccctgcacgcaggctctgaaggggtcaaggtnnnnnnnnncgtgctctcc
cagaagtccgtctctgagtccagccccggggacagccccgtcaaacctccggaaggctcc
acaggtgtggcccggtcccagcctccagtggcccatgccgggcaagtctatggggagcag
ccgcccaagaagctggagccagcgtcggagggcaagagcgccgaggctgtcagccagtgg
cttgccacgttccagctgcagctctacgcccctaacttcatcagcgcgggctatgacctg
cccaccatcagccgcatgacccctgaggacctcacggccatcggggtcaccaagccaggc
caccggaagaagatcactgcagagatcagcggcttgaacatccccgactggctgcctgag
cacaaacccgctaacctggccatgtggctgtccatgatcggcctggcccagtactacaag
gtgctggtggacaacggctacgagaacatcgacttcatcaccgacatcacctgggaggac
ctgcaggagatcggcatcaccaagctgggacaccaaaaaaagctgatgttggctgtgagg
aaactggctgagctgcagaaagcagagtatgctaaatatgaggggggacccctgcgccgg
aaggcaccccagtctcttgaagtgatggccattgagtcgccacccgcgcctgagcctgcc
ccggctgactgccagtctcctaagatgaccaccttccaggacagtgagctcagtggcgag
ctgcaggctgccatgactggccctgctgagggggctgctgccaccgctgccactgctgag
aagccctccaaccacctgccgcccaccccaagggcctccatgcggcaggagcccagcctg
ggcgggcgggcacggcacatgagcagctctcaggagctgctgggcgatgggccccccggg
cctggcagccccatgtcacgaagccaggaatacctgctggatgacgggccagcccctgga
accccacccaaggaggcccggccgagccgccatggccatagcgtcaagcgggccagtgtg
cccccagtgcctggaaagccacggcaggtccttccaccaggtgccagccacttcacaccc
cctcagacgcccacgaaagcccggccagcctccccccaggccctggggggacctcatggt
ccagccccagccacagccaaggtgaagcccaccccacagctgctgccaccaacagagcga
cccatgtcaccccgctcactgcctcagtcacccacacaccgcggctttgcctacgtgctg
ccccagcctgtggagggcgaggcagggccagctgctccggggcctgtgcccgtgcccacg
ctgttcctgccccccgaggccgacgtggagccggagcggcccaagaagcgcgcccacagc
ctgaaccgctacgcagcatctgacagcgagccagagcgggacgagctgctggtgctggct
gccggagggccctatgccacagtccagagacgtgtgggccgc

DBGET integrated database retrieval system