KEGG   Equus przewalskii (Przewalski's horse): 103567002
Entry
103567002         CDS       T04644                                 

Definition
(RefSeq) nitric oxide synthase, inducible-like
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz00220  Arginine biosynthesis
epz00330  Arginine and proline metabolism
epz01100  Metabolic pathways
epz04020  Calcium signaling pathway
epz04066  HIF-1 signaling pathway
epz04146  Peroxisome
epz04371  Apelin signaling pathway
epz04926  Relaxin signaling pathway
epz05010  Alzheimer disease
epz05014  Amyotrophic lateral sclerosis
epz05133  Pertussis
epz05140  Leishmaniasis
epz05142  Chagas disease
epz05145  Toxoplasmosis
epz05146  Amoebiasis
epz05152  Tuberculosis
epz05200  Pathways in cancer
epz05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:epz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    103567002
   00330 Arginine and proline metabolism
    103567002
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103567002
   04066 HIF-1 signaling pathway
    103567002
   04020 Calcium signaling pathway
    103567002
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    103567002
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    103567002
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103567002
  09162 Cancer: specific types
   05222 Small cell lung cancer
    103567002
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103567002
   05014 Amyotrophic lateral sclerosis
    103567002
  09171 Infectious disease: bacterial
   05133 Pertussis
    103567002
   05152 Tuberculosis
    103567002
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103567002
   05145 Toxoplasmosis
    103567002
   05140 Leishmaniasis
    103567002
   05142 Chagas disease
    103567002
Enzymes [BR:epz01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     103567002
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1
Other DBs
NCBI-GeneID: 103567002
NCBI-ProteinID: XP_008541810
LinkDB
Position
Un
AA seq 1160 aa
MREGLGAACEAAWPRLCRLLRRILRPQSTCGRRRASSVTQDDPKGHSLGKHRNESLQPVT
GMAKKSPESLVKLDVPPSACPRHVRIKNWGNGMTFEDMLHREANGEVACKSKSCLAAVMN
PKSMTRGPRDKPTPPDELLPHAIQFVNQYYNSFKEAKIEEHLARLEAVTKEIETTGTYQL
TGDELIFATKQAWRNAPRCIGRIQWSNLQVFDARSCSTAQEMFEHICRHLRYSTNNGNIR
SAITVFPQRSDGKHDFRIWNAQLIRYAGYQMPDGTIRGDPASVELTQLCIDLGWKPKYGR
FDVMPLVLQADGRDPELFEIPPDLVLEVPMEHPKYEWFQELGLKWYALPAVANMLLEVGG
LEFPGCPFNGWYMGTEIGVRDYCDAQRYNILEEVGRRMGLETHKLASLWKDRAVIEINVA
VLHSFQKQNVTIMDHHSAAESFMKHMQNEYRSRGGCPAXXXXXXXXXXXXXSGSITPVFH
QEMLNYVLSPFYYYQVEAWKTHVWQDEKQSPRRRQIRFKVLVKAVLFASMLMRKTMASRV
RATILFATETGKSETLARDLGTLFSCAFNPKVLCMDEYQLSYLEEEQLLLVVTSTFGNGD
SPGNGEKLKKSLFMLKKLTNKFRYAVFGLGSSMYPQFCAFAHDIDQKLSHLGASQLTPTG
EGDELGGQEDAFRSWAVQTFKTACETFNVRGKHQIQIPKLYTSNETWDPHHYRLVQDPQP
LDLSKALSSMHAKNVFTMRLKSRQNLQSPKSSRTTLLIELSSEASQGLSYLPGEHLGVFP
GNQPALVQGILERVVDGPAPDQPMRLETLDESGSYWVKDKRLPPCSLSQALTYFLDITTP
PTQQLLRKLAQLATKEAERQRLETLCQPLEYNKWKFTNSPTFLEVLEEFPSLRVSAGFLL
SQLPILKPRYYSISSSRDRTPREVHLTVAVLTYRTRDGQGPLHHGVCSTWLSSLKPQDPV
PCFVRSATGFRLPENPSHPCILVGPGTGIAPFRSFWLQRLHDAENRGLQGGRMTLVFGCR
HPDEDHLYQEEMLEMARKGVLHEVHTAYSRLPGQPKVYVQDILRQQLASEVLRVLHEEQG
HIYVCGDVRMARDVAHTLKQLVAAKLSLSEEQVEDYFFQLKSQKRYHEDIFGAAVPYKLR
KDGAAGQPSHPRAPSAPGKS
NT seq 3483 nt   +upstreamnt  +downstreamnt
atgcgcgagggcctgggcgcggcgtgtgaggccgcctggccccgactctgccggctcctc
cgtagaatcctccggccacagagcacctgcggtcgccgccgagccagttcagtgacacag
gatgaccccaagggtcacagcctcggcaagcacaggaatgagtccctgcagcccgtcacc
ggaatggcaaagaagtctccagaatccctggtcaagctggatgtgcccccctcggcctgc
ccacggcatgtgaggatcaaaaactggggtaacgggatgactttcgaggacatgcttcac
cgcgaggccaatggggaggtcgcttgcaagtccaagtcttgcctggcagccgtcatgaac
cccaaaagtatgaccagagggcccagggacaagcctacccccccagatgagcttctacct
cacgctatccaatttgtcaaccagtattacaactccttcaaagaagcaaaaatagaggaa
catctggccaggctggaagccgtaacaaaggagatagaaacaacaggaacctaccagctg
acgggagatgagctcatctttgccaccaagcaggcctggcgcaatgccccccgctgcatc
gggaggatccagtggtccaacctacaggtctttgacgcccggagctgttctactgcccag
gaaatgttcgaacacatctgcagacacctgcgttactccaccaacaatggcaacatcagg
tcggccatcaccgtgttcccccagcggagcgatggaaagcatgacttccggatctggaat
gctcagctcatccggtatgccgggtaccagatgcctgatggcaccatcagaggggaccct
gcctctgtggagttaacccagctgtgcatcgacctgggctggaagcccaagtacggccgc
ttcgatgtgatgcctctggtcctgcaggctgatggccgcgaccctgagctctttgaaatc
cctcctgaccttgtgctcgaggtgcccatggaacatcccaagtacgagtggttccaggag
ctggggctgaagtggtacgcactgccagcagtggccaacatgctgcttgaggtgggcggc
ctggagttcccagggtgccccttcaacggctggtacatgggcacggagattggggtccga
gactactgtgatgcccagcgctacaacatcttggaggaagtggggagaaggatgggcctg
gaaacacacaagctggcctccctctggaaggaccgggctgtcatcgagatcaatgtggct
gtgctccacagtttccagaagcaaaatgtgaccatcatggaccaccactcagctgcagag
tccttcatgaagcacatgcagaatgagtaccggtcccgtgggggctgcccggcnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnttctgggagcatcacccccgtgttccac
caggagatgttaaactatgtcctgtcccctttctactactaccaggtggaggcctggaaa
acccacgtctggcaggatgagaagcagagcccccggagaagacagattcgattcaaggtc
ttggttaaagccgtgctctttgcctccatgctgatgcgcaagaccatggcgtcccgagtc
agagccacaatcctctttgccacggagacgggaaaatcggaaacgctggcccgggacctg
gggactttgttcagttgtgctttcaaccccaaggttctctgcatggatgagtaccagctg
agctacctggaagaggagcagcttctgctggtggtgaccagcacgtttggcaacggagac
tcccccggcaacggagagaaattgaagaaatccctcttcatgctgaaaaagctcacgaac
aagttcaggtatgctgtgtttggccttggctccagcatgtaccctcagttctgtgccttc
gctcatgacattgaccagaagttgtctcacctgggggcctcgcagctcacccccacaggg
gaaggggatgagctcggtggccaggaggatgccttccgcagctgggcggtgcaaaccttc
aagacagcctgtgagacgttcaatgtccgaggcaaacaccaaattcagatccccaagctc
tacacctccaatgagacctgggacccgcatcactacaggctcgtgcaagacccgcagcct
ttggacctcagcaaagccctcagcagtatgcacgccaagaatgtgttcaccatgaggctt
aaatcgcggcagaatctacagagtccgaagtccagccgcaccaccctcctgatagaactc
tccagtgaggccagccaaggtctgagctacctgccaggggagcatcttggggttttccca
ggcaaccagccggctctggtccaaggtatcttggagcgagtggtggatggccctgcaccc
gaccaacccatgcgcctggagaccctcgacgagagcggcagctactgggtcaaggacaag
cggctgcccccctgctcactcagccaggcactcacctatttcctggacatcaccacaccc
ccaacccaacagcttctccgaaagctggcccagctggccaccaaagaggctgagaggcag
agactggagaccctgtgccagcccttggagtacaacaagtggaagttcaccaacagcccc
acattcctggaggtgctggaggagttcccgtccctgcgggtgtctgctggcttcctgctc
tcccagcttcctattctgaaaccccggtactactccatcagctcctccagggaccgcaca
cccagggaggtccacctcaccgtggctgtgctcacgtaccgcactcgagatggtcagggt
cccctgcatcatggcgtctgcagcacatggctcagcagcctgaagccccaagacccagtg
ccctgctttgtgcgaagtgccactggcttccggctccctgagaacccgtctcatccttgc
atcctcgtcgggcctggcacgggcattgcccccttccgcagtttctggctgcagcggctc
catgatgccgagaacagagggctccaaggtggccgcatgaccctggtgttcgggtgccgc
cacccagatgaggaccacctctatcaggaggagatgctggagatggcccggaaaggggtg
ctgcatgaggtgcacacggcctattctcgcctccctggacagcccaaggtctatgttcaa
gacatcctgcggcagcaactggccagtgaggtgctccgtgtgctccatgaggagcaaggc
cacatctatgtctgtggggacgtgcgcatggcccgggacgtggcccacaccctgaagcag
ctggtggctgccaagttgagcctgagtgaggagcaggtcgaggactatttcttccagctt
aagagccagaagcgctaccatgaagacatctttggtgctgcagttccctacaagctgaga
aaggatggggccgcagggcagcccagccatcccagagcgccatcagccccagggaaaagt
taa

DBGET integrated database retrieval system