KEGG   Equus przewalskii (Przewalski's horse): 103567259Help
Entry
103567259         CDS       T04644                                 

Gene name
SOD1
Definition
(RefSeq) superoxide dismutase 1
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz04146  Peroxisome
epz04213  Longevity regulating pathway - multiple species
epz05014  Amyotrophic lateral sclerosis (ALS)
epz05016  Huntington disease
epz05020  Prion diseases
Brite
KEGG Orthology (KO) [BR:epz00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    103567259 (SOD1)
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    103567259 (SOD1)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    103567259 (SOD1)
   05016 Huntington disease
    103567259 (SOD1)
   05020 Prion diseases
    103567259 (SOD1)
Enzymes [BR:epz01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     103567259 (SOD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 103567259
NCBI-ProteinID: XP_008542119
LinkDB All DBs
Position
Un
AA seq 131 aa AA seqDB search
IKEGGPVVLKGFIEGLTKGDHGFHVHEFGDNTQGCTTAGAHFNPLSKKHGGPKDEERHVG
DLGNVTADENGKADVDMKDSVISLSGKHSIIGRTMVVHEKQDDLGKGGNEESTKTGNAGS
RLACGVIGIAP
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
ataaaggaaggtgggcccgtcgttctgaagggattcattgaaggattaaccaaaggcgat
cacggattccacgtccacgagtttggagataatacacaaggctgtaccactgctggtgct
cactttaatcctctgtcgaaaaaacacggtggaccaaaggacgaagagaggcatgttgga
gacctgggcaatgtgactgctgatgaaaatggtaaggctgatgtggatatgaaagattct
gtgatctcactctcgggaaagcattccatcattggccgcacaatggtggtccacgagaaa
caagatgacctgggcaaaggtggaaatgaagaaagtacaaagacggggaacgctggcagt
cgtctggcttgtggtgtgattgggatcgctccgtaa

DBGET integrated database retrieval system