KEGG   Equus przewalskii (Przewalski's horse): 103567708
Entry
103567708         CDS       T04644                                 

Gene name
TGFBR2
Definition
(RefSeq) transforming growth factor beta receptor 2
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz04010  MAPK signaling pathway
epz04060  Cytokine-cytokine receptor interaction
epz04068  FoxO signaling pathway
epz04144  Endocytosis
epz04218  Cellular senescence
epz04350  TGF-beta signaling pathway
epz04380  Osteoclast differentiation
epz04390  Hippo signaling pathway
epz04520  Adherens junction
epz04659  Th17 cell differentiation
epz04926  Relaxin signaling pathway
epz04933  AGE-RAGE signaling pathway in diabetic complications
epz05142  Chagas disease
epz05161  Hepatitis B
epz05166  Human T-cell leukemia virus 1 infection
epz05200  Pathways in cancer
epz05202  Transcriptional misregulation in cancer
epz05210  Colorectal cancer
epz05212  Pancreatic cancer
epz05220  Chronic myeloid leukemia
epz05225  Hepatocellular carcinoma
epz05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:epz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103567708 (TGFBR2)
   04350 TGF-beta signaling pathway
    103567708 (TGFBR2)
   04390 Hippo signaling pathway
    103567708 (TGFBR2)
   04068 FoxO signaling pathway
    103567708 (TGFBR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103567708 (TGFBR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103567708 (TGFBR2)
  09143 Cell growth and death
   04218 Cellular senescence
    103567708 (TGFBR2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    103567708 (TGFBR2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    103567708 (TGFBR2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    103567708 (TGFBR2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103567708 (TGFBR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103567708 (TGFBR2)
   05202 Transcriptional misregulation in cancer
    103567708 (TGFBR2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103567708 (TGFBR2)
   05212 Pancreatic cancer
    103567708 (TGFBR2)
   05225 Hepatocellular carcinoma
    103567708 (TGFBR2)
   05226 Gastric cancer
    103567708 (TGFBR2)
   05220 Chronic myeloid leukemia
    103567708 (TGFBR2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103567708 (TGFBR2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103567708 (TGFBR2)
   05161 Hepatitis B
    103567708 (TGFBR2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    103567708 (TGFBR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:epz01001]
    103567708 (TGFBR2)
Enzymes [BR:epz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     103567708 (TGFBR2)
Protein kinases [BR:epz01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   103567708 (TGFBR2)
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase Pkinase_fungal APH
Other DBs
NCBI-GeneID: 103567708
NCBI-ProteinID: XP_008542636
LinkDB
Position
Un
AA seq 550 aa
LSNHLIYLSLPSRLVNNDIMITDNNGAVKLPQLCKFCDVTSSTCDNQKSCMSNCSITSIC
EDPHEVCVAVWRKNDKNITLETVCHDPKLTYHGFVLEDAASPKCIMKEKKVSGETFFMCS
CSSDECNDHIIFSEEYATNNPDLLLVIFQVTGVSLLPPLGIAIAVIITFYCYRVHRQQKL
SPSWETSKPRKLMEFSEHLAIILEDDRSDISSTCANNINHNTELLPIELDTLVGKGRFAE
VYKAKLKQNTSEQFETVAVKIFPYEEYASWKTEKDIFSDINLKHENILQFLTAEERKTEL
GKQYWLITAFHAKGNLQEYLTRHVISWEDLRKLGSSLARGIAHLHSDHTLCGRPKMPIVH
RDLKSSNILVKNDLTCCLCDFGLSLRLDPTLSVDDLANSGQVGTARYMAPEVLESRMNLE
NVESFKQTDVYSMALVLWEMTSRCNAVGEVKDYEPPFGSKVREHPCVESMKDNVLRDRGR
PEIPSSWLNHQGIQMVCETLTECWDHDPEARLTAQCVAERFSELEHMDRLSGRSCSEEKI
PEDGSLNTTK
NT seq 1653 nt   +upstreamnt  +downstreamnt
ttatctaatcatttaatttatctttctctcccctcccggctagttaataacgacatcatg
atcactgacaacaatggtgcagtcaagcttccacaactgtgtaaattttgtgacgtgaca
tcttccacctgtgacaatcagaaatcctgcatgagcaactgcagcatcacatccatctgt
gaggatccacacgaagtctgtgtggctgtctggagaaagaatgataagaacataacacta
gagacggtttgccatgaccccaagctcacctaccatggatttgttcttgaagatgctgct
tctccaaagtgtattatgaaggaaaaaaaagtgtctggcgagactttctttatgtgttcc
tgtagctctgatgagtgcaacgaccacatcatcttctcagaagaatatgccaccaacaac
cctgacttgttgttagtcatattccaagtgacaggcgtcagcctcctgccaccgctggga
attgccattgcggtcatcatcaccttctactgctaccgcgttcaccggcagcagaagctg
agcccgtcctgggagaccagcaagccacggaagctcatggagttcagcgagcaccttgcc
atcattctggaagacgaccgctccgacatcagctctacgtgtgccaacaatatcaaccac
aacacagagctgctgcccattgagctggacaccctggtggggaaaggtcgctttgctgag
gtctacaaggccaagctgaagcagaacacttcagagcagttcgagaccgtggcagtcaag
atctttccttatgaggagtacgcctcctggaagacagagaaggacattttttcagacatc
aacctgaagcatgagaacatactccagttcctgacagctgaggagcgaaagacagaactg
ggaaagcaatattggctgatcaccgctttccatgccaagggcaacctacaggaatacctt
acacggcatgtcatcagctgggaggacctgcgcaagctaggcagctccctagcccggggc
attgctcacctgcacagtgaccacaccctgtgcgggaggcccaagatgcccattgtgcac
agggacctcaagagctccaacatcctcgtgaagaatgacctgacctgctgcctgtgtgac
tttgggctttccctgcgtttggacccgaccctgtctgtggatgacctggccaacagtggg
caggtgggaactgcaagatacatggccccagaagtcctggagtccaggatgaatttggag
aatgttgagtccttcaagcagacagatgtctactccatggctctggtgctctgggaaatg
acatctcgctgtaacgcagtgggagaagtgaaagattatgagcctccatttggttccaag
gtgcgggagcatccctgtgtcgaaagcatgaaggacaatgtcttgagagatcgaggacga
ccagaaattcccagctcctggctcaaccaccagggcatccagatggtgtgtgagactctg
accgagtgctgggaccacgacccggaggcccgtctcacggcccagtgcgtggcagaacgc
ttcagcgagctggagcacatggacagactctcggggaggagctgctccgaggagaagatt
cccgaagacggctcgctgaacactaccaaatag

DBGET integrated database retrieval system