KEGG   Eubacterium rectale M104/1: ERE_11330Help
Entry
ERE_11330         CDS       T02588                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
era  Eubacterium rectale M104/1
Pathway
era00473  D-Alanine metabolism
era00550  Peptidoglycan biosynthesis
era01100  Metabolic pathways
era01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:era00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    ERE_11330
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ERE_11330
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    ERE_11330
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:era01011]
    ERE_11330
Enzymes [BR:era01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     ERE_11330
Peptidoglycan biosynthesis and degradation proteins [BR:era01011]
 Precursor biosynthesis
  Amino acid ligase
   ERE_11330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 CPSase_L_D2 RimK GARS_A ATP-grasp ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: CBK93148
UniProt: D4JHQ1
LinkDB All DBs
Position
complement(1178095..1179150)
Genome map
AA seq 351 aa AA seqDB search
MNIVVLAGGLSTERDVSFKTGSMVAKALKENGHKVILLDVFMGYSDREEDLTGIFDRADE
ISVQVSDIPTEAPDLAKVKASRKDQSPCFFGPNVIKMCQMADIVFMALHGENGENGKIQA
AFDLFGVKYTGSDYLSSAIAMNKETSKQFFLANGIPTPKGISMTRATRQDDITKLDLTLP
CVVKPCCGGSSIGVTIVKDAAEFKAALDDAFKWENELVIEEFVQGREFSVGVIEGKALPI
IEIAPKEGFYDYKNKYKAGSTVETCPAELPEQVTKDMQHYAEEVARVIGLDTYSRSDFLL
NDKNEMFCLEANTLPGMTPTSLLPQEAAVIGMSFNQLCEHLIDISLKKYEV
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcgtagtacttgccggagggctcagcacagagagagatgtttccttcaagaca
ggaagcatggtagctaaggcactcaaagagaacggccacaaagttatattattggatgta
tttatgggatatagcgacagggaggaggacctgacaggtatatttgaccgcgcggacgag
ataagcgtgcaggtcagtgatattccgacagaggcacctgacctcgcaaaggtaaaggct
tccagaaaggatcagtcaccttgcttcttcggaccaaatgtcatcaaaatgtgtcagatg
gcggacattgttttcatggctctccacggagaaaacggagagaacggaaagatacaggca
gcatttgacctcttcggtgtcaaatatacaggcagcgattatttaagctcagccatcgcc
atgaacaaggagacatcaaagcagttcttccttgcaaacggtatccctactccaaagggt
atttccatgacaagagcgaccagacaggacgatatcacaaagcttgacctgacacttcca
tgcgtggtaaagccatgctgcggcggttcaagcatcggtgtcaccatcgttaaggatgcg
gcagagttcaaggcggcacttgacgatgccttcaagtgggaaaatgagctggttatcgag
gagtttgtacagggcagggagttctctgtcggcgttatcgagggcaaggctcttcctatt
atagagattgcaccgaaggagggcttctacgattataagaataaatacaaggcgggcagt
acagtagagacatgtccggccgagcttcctgagcaggtgacaaaggatatgcagcactat
gccgaggaggttgcgcgtgttatcgggcttgacacatattcacgctcagactttttactc
aatgacaaaaatgagatgttctgcctcgaggcaaacacactgcctggcatgactccgacc
agtcttctgccacaggaggccgcagttatcggcatgagctttaatcagctctgtgagcat
ctgattgacatatctttgaaaaaatatgaggtgtag

DBGET integrated database retrieval system