KEGG   Eubacterium rectale M104/1: ERE_17310Help
Entry
ERE_17310         CDS       T02588                                 

Definition
(GenBank) Threonine dehydrogenase and related Zn-dependent dehydrogenases
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
era  Eubacterium rectale M104/1
Pathway
era00040  Pentose and glucuronate interconversions
era00051  Fructose and mannose metabolism
era01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:era00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ERE_17310
   00051 Fructose and mannose metabolism
    ERE_17310
Enzymes [BR:era01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     ERE_17310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 2-Hacid_dh_C AlaDh_PNT_C TrkA_N NAD_binding_3 Shikimate_DH NADH_4Fe-4S 3HCDH_N AdoHcyase_NAD ThiF
Motif
Other DBs
NCBI-ProteinID: CBK93671
UniProt: D4JJ74
LinkDB All DBs
Position
complement(1766352..1767380)
Genome map
AA seq 342 aa AA seqDB search
MLQQVMTNPGEIIFREVPVPEVKENQVLVKIMNIGVCGSDIHVYHGKHPFTKYPVTQGHE
VSGEITELGKNVTEFHVGQKVTIEPQVYCGHCYPCRHGKYNLCEELKVMGFQTTGTASEY
FAVDASKVTPIPEDMSYEEGAMIEPLAVAVHGVKQMGDVAGMNIAVLGAGPIGNLVAQAA
KGMGAAKVMITDISDLRLAKAKECGIDVCVNTLNKDFGEAMIEAFGPDKADVIYDCAGNN
ITMGQAIKYARKGSTIVLVAVFAGMAEVDLAVANDHELDIKSTMMYRHDDYIDGIRLVNE
GKVHLKPLISKTFAFKDYLKAYQYIDDNRETTMKVIINVNEK
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgttacagcaggtaatgacaaatccaggagaaattattttcagagaggttccggttccg
gaggtaaaggaaaatcaggttttggtaaagattatgaatattggtgtttgtggatcagat
attcatgtttatcatggaaaacatccgtttacaaaatatccggtaacacaaggacatgag
gtttcaggtgagattacagaacttggaaaaaatgtcacagagtttcatgtgggacagaag
gtgacgatagagcctcaggtatattgtggacattgctatccatgtcgtcatggaaagtat
aatctctgtgaggaattaaaagttatgggatttcagacgacaggaacagcatctgagtat
tttgcagtggatgcatctaaagtaacacctattccagaagatatgtcctatgaagaagga
gctatgatcgaacctcttgctgtggcagttcatggtgtaaaacagatgggcgatgtggct
ggcatgaatattgcagtccttggagcaggaccaattggaaatctcgtggcacaggcagca
aaaggaatgggggcagcgaaagtgatgatcacagatatcagtgatcttagactggcaaag
gcaaaagaatgtggaattgatgtgtgtgtgaataccctaaataaagacttcggtgaggca
atgatcgaagcatttggaccggataaggcggatgtgatctacgactgtgccggaaacaat
atcacaatgggacaggcaattaaatatgcaagaaaaggaagcacgattgtacttgtggct
gtttttgcaggaatggcagaagtagatcttgcagtggcaaatgatcacgaacttgacatt
aagagcacgatgatgtaccgccatgatgattacatagatggaatcagactggtaaatgag
ggaaaagttcatttgaaaccgcttatctcaaagacatttgcttttaaagattatctgaag
gcataccagtatattgatgataaccgcgagacaacgatgaaagtaattatcaacgtcaat
gaaaagtaa

DBGET integrated database retrieval system