KEGG   Erysipelotrichaceae bacterium I46: A4V01_08925Help
Entry
A4V01_08925       CDS       T04439                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
erb  Erysipelotrichaceae bacterium I46
Brite
KEGG Orthology (KO) [BR:erb00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:erb01001]
    A4V01_08925
Enzymes [BR:erb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     A4V01_08925
Protein kinases [BR:erb01001]
 Serine/threonine kinases: Other
  Bacterial family
   A4V01_08925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH RIO1 Kinase-like PIP49_C Peptidase_M56 Kdo Seadorna_VP7 Amnionless DUF3377 DUF2232 Pkinase_fungal YrbL-PhoP_reg
Motif
Other DBs
NCBI-ProteinID: ANU69039
UniProt: A0A1C7HRN7
LinkDB All DBs
Position
1860721..1862454
Genome map
AA seq 577 aa AA seqDB search
MNNNNKMIAERYMIVSSLGEGGMADVYLAIDTILNREVAIKVLRGELSKDPVTLLRFQRE
ANAVSKLNHPNVVDVYDVGEFEGRHYIVMEYVRGRTLKQLISQRGALHQEEAVNIMIQLT
SAVQHAHENDIIHRDIKPQNVLVKDDGTVKITDFGIALAHDTVQLTQSDAVLGSAHYLAP
ETTRGETPSNQVDIYALGIVFYELLTGNVPFHGDNPVQIAMKHLREEIPSVRDFNPTLPQ
SVENIIIKATVKNRKLRYQSAKDMLYDLHRCLLPEYAHVEKLVFEEEHPQPTMVMEQRKQ
KQTKKTEVRKKHVEPIEEDEEDDSGNRKITKIIIAMIVGLCVIGVAAFVLMSGIFDKEKM
IKVPELSTSQTQQEAIQTLTSSGFKKDNITIKQELSDDVEKGHVIRVSPDTGEEIGEKSK
LTLTVSRGTWFVVKDYRHRLPEEVEKELNEQNPNIKLEISYEQRANTWPGYIAEQSGLEI
GEKLDPDKEYTLKITVSQLMSWKIEGVVGKTAEEAIALIKEKTGILPVSDERSYDDLSEE
EQKTIKKGVVTDVDPAEGTEYVQQMENPNVITIRFYK
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgaataacaacaacaaaatgattgccgagcgctatatgatcgtttcctcattgggggaa
ggcggtatggcggatgtctatctggcaatcgataccatactgaaccgtgaggtggcaatc
aaggtgctgcgtggggagctcagcaaggatccggtgacactgctgcgctttcagcgggag
gccaatgcggtcagcaagctgaaccatcccaatgtagtggatgtatacgatgtcggagag
tttgagggacgtcactatatcgtaatggaatatgtacgcggccgtacactgaagcagctg
atttcccagcgtggggcactgcatcaggaagaggctgtaaacatcatgattcagctgacc
agcgctgtacagcatgcccatgaaaacgatattattcaccgggatatcaagcctcagaat
gttctggttaaggatgatggtacggtaaagattaccgatttcggaattgcgctggcgcac
gatacggtacagctgacgcaaagtgatgcggtactgggcagtgcgcactatctggctccg
gaaacaacacggggagaaacaccaagcaatcaggtggatatctatgcgcttggtatcgtg
ttttatgagcttttgaccggaaatgttcccttccatggagacaaccccgtccagattgca
atgaagcatctgcgtgaggagataccaagtgttcgtgatttcaatccgacactgccgcag
tccgtggagaacatcatcatcaaggcaaccgtgaaaaaccgcaagctgcgctatcagagt
gcgaaggatatgctgtatgacctgcaccgctgcctgcttccggaatatgcacatgtcgaa
aagctggtgtttgaggaagagcatccgcagccgacaatggtcatggagcagcgcaaacag
aagcagactaagaaaactgaggtgcgcaaaaagcatgtggagccgattgaagaggatgaa
gaggatgattccggtaatcggaaaatcacaaaaatcatcattgctatgattgtcgggctg
tgtgtgatcggtgttgcggcctttgtactgatgagcggaatttttgataaagaaaagatg
attaaggtcccggagctgtccacatcacagacgcagcaggaggcaattcagacgctgacc
tccagcggatttaaaaaggataatattacgattaagcaggagctgagtgatgatgtggaa
aaaggtcatgtcatccgtgtatccccggataccggagaggaaattggtgaaaaatccaag
ctgacgctgactgtttccagaggaacctggtttgtggtaaaggattaccgccatcgttta
ccggaggaagtggaaaaggaactgaatgaacagaatccaaacatcaagctggaaatcagc
tatgagcaaagggcgaatacgtggcccggatatatagcggaacaaagcggcttggaaatc
ggagaaaagctggatccggataaagaatatacattaaaaataactgtcagtcagctgatg
agctggaagatagagggcgttgtaggaaaaacagcagaagaggccattgctttaattaaa
gaaaagacgggaatacttccggtatcggatgagcgttcctatgatgacctgagtgaagag
gaacaaaagaccattaaaaaaggagtcgttacagacgtggatcccgcagagggaacggaa
tatgtccagcagatggagaatccgaatgttataacgataaggttttacaaatga

DBGET integrated database retrieval system