KEGG   Eremothecium cymbalariae: Ecym_1135Help
Entry
Ecym_1135         CDS       T02237                                 

Definition
(RefSeq) hypothetical protein
Organism
erc  Eremothecium cymbalariae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Zn_clus
Motif
Other DBs
NCBI-GeneID: 11472563
NCBI-ProteinID: XP_003644204
UniProt: G8JMN2
LinkDB All DBs
Position
1:complement(276229..278697)
Genome map
AA seq 822 aa AA seqDB search
MNSASVSSKANIIGIPADDPRYTNPVSQEIGSNGKPKRNTFACSSCHAVKQRCIPTDAND
IYRKPCTRCLKFKKLCVFDLSKRTRRKRRSNHVAAAAASAAKNGNMMHSVLILGRNSRLP
DKGHFPQSQHYVTKDIHRHQAPQSTNWDNASPLEVFSERPSNQCIDVARVSPGVSTLPAP
FPPPSLVHGSVDHDQLTDPEGEDVEENDDDDDRGKALLRQEFGMLSDCFKEKLGHVSERL
SIEAKKWNLFVESAAAIPIPSDPVAIGILSAEDAMHRLELYEKYMLSEHQLSFIRIPKYD
SIKQFRLQQPILFSTLLAVASVVMPHSPGLELINMKLDNLVLTHITHYCMRNGEKAVELL
KSLILLCLWYNFPEWSNKSRYHHFNYLCYNLVRELSVAYMHKSLTIIGENHDQHKVGTIL
EEDPDYPRLILLVYISSLSISIFLHQPIQLKWFPMVEKACNDILSGEYVSELYSVEENQM
LVTFAKLHLCLDRTYTMLSENSDGDFVTIDQENLINVLVEELTVIKMQIPARFLNNMTYF
YTVEAYVYESVVSSYFLKNTNPAASLPENIGKAFTTAAQKSLSALKGLLDLDPNIVVSLP
LLNISRVVYTMGMALLRLRYTSITVPSFEHLKSSTVEILPVLQRFAIFLDELNEKFPYNR
AISKLQYVAALFIHTYSNKLRTCIYDGDSPFESFESLHDISSTTTFDINSHISKQDIRDY
LKFDAFHNGTLHEFQSDLLKMTSIMDQRDKKLHNIKVNSIHKSPVKTHSFHITNGQAARE
PTAAAHMIDYLSDYLVDNAFVENEYDAFNEEVCGSVLFNQLK
NT seq 2469 nt NT seq  +upstreamnt  +downstreamnt
atgaactccgctagcgtttccagcaaggccaatatcattggtataccagctgacgatccc
agatacacgaatcctgtgtcgcaggagattggatctaacgggaaaccgaaacggaacact
tttgcgtgttcaagctgtcacgctgtgaagcagcgttgtattccgactgacgcgaacgat
atataccgtaaaccatgtacccggtgcctaaagttcaagaagctgtgtgtgtttgatctg
tcaaaacgtacaagacgtaagcggcgttctaatcatgtcgctgctgccgccgcttctgcc
gctaagaacgggaacatgatgcattcagtgttgatccttgggcggaattcacgacttcct
gataaaggtcatttccctcagtcacagcattacgtcaccaaggatatacaccgccaccag
gcaccccagtcgacgaactgggataatgcttcgccattggaagtattttctgagaggcca
tcgaaccaatgtatcgatgtggcgagggtttcaccgggtgtatcgactttgcccgctccg
ttcccaccgccgtcgcttgttcatggttctgtagatcatgatcagttaactgacccggag
ggtgaagatgtagaagaaaacgacgacgatgatgacagaggaaaggcccttttgcgacaa
gaatttggaatgctatcggactgttttaaagagaaattaggacacgtttctgaaaggcta
agcatagaagctaaaaaatggaatttgttcgttgaatctgcggcagcgattcccatcccc
agtgatcctgttgcaattggtattctctcggcagaggatgcaatgcatcgcttagagctc
tatgaaaaatacatgcttagtgagcatcagttatcgtttatccgtattccaaagtatgac
tcgatcaagcagttcaggcttcagcagcctatcttattctctactctgcttgctgttgca
tctgttgtgatgcctcattccccaggactcgaactaatcaacatgaagctggataacctt
gtgcttactcatattacccactattgcatgagaaatggtgagaaggcggtcgaactcttg
aaatcattaatcctgctttgtctttggtacaactttcctgaatggtcgaataagtccaga
taccaccactttaactacctttgttacaacttggttagagaactcagcgtggcgtatatg
cacaaatcgttgaccattattggggagaatcacgatcaacacaaagttggcactattctt
gaggaagaccctgactatccacggttgatacttctggtgtatattagctctttgagtatc
tctatatttttgcaccagcctatccagctcaagtggtttcccatggtggagaaggcttgt
aatgatattctgagtggcgagtacgtttctgaactgtactctgtggaggaaaatcaaatg
ttagtaacatttgcaaaattgcatttatgtctggatagaacttataccatgctaagtgaa
aattcagatggtgattttgttaccattgaccaagaaaatttgatcaatgtcttggttgaa
gaattaactgttattaaaatgcagatacctgcacgcttcctcaataatatgacatacttt
tatactgtggaggcatatgtatacgagtctgtggtttcgagctattttttaaagaatacc
aatcctgctgcgtccttaccggagaatattggtaaggcattcacaacagcggcccaaaag
tccctttctgccctcaaagggttgctggatttggatcccaatattgttgtttcacttcca
cttttgaatatctctagagtcgtatacaccatgggaatggctcttttacggttaaggtat
acgtcaataactgtaccatccttcgaacatttaaaatcatccacggttgaaattttaccc
gtccttcagagatttgctatatttttggatgaattaaacgagaagtttccatacaacagg
gctatttctaaattgcagtatgtggctgctttattcattcatacttactctaacaaacta
aggacttgtatatatgatggtgatagtccatttgaatcttttgaatctttacatgatata
tcttcaacaaccacgtttgatataaactctcatatatcaaagcaggatattagagactat
ttgaaattcgatgcttttcataacgggactttacatgaatttcagtcagatttgctaaaa
atgacaagcataatggatcagagggataagaaattacataatataaaggttaattcgata
cacaaaagccccgttaagacacattcatttcatattactaatggacaagcagctcgagaa
ccaaccgccgccgcacatatgatagattatctatcagattatttggttgacaatgcattc
gtggaaaatgaatacgatgcctttaacgaagaagtctgcggaagcgtgctattcaatcag
ctaaaatag

DBGET integrated database retrieval system