Eremothecium cymbalariae: Ecym_2029 Help Entry Ecym_2029         CDS       T02237                                  Name (RefSeq) Hypothetical protein   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism erc  Eremothecium cymbalariae Pathway erc03420   Nucleotide excision repair erc04111   Cell cycle - yeast erc04120   Ubiquitin mediated proteolysis erc04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:erc00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     Ecym_2029    04120 Ubiquitin mediated proteolysis     Ecym_2029   09124 Replication and repair    03420 Nucleotide excision repair     Ecym_2029  09140 Cellular Processes   09143 Cell growth and death    04111 Cell cycle - yeast     Ecym_2029  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:erc04121]     Ecym_2029    03400 DNA repair and recombination proteins [BR:erc03400]     Ecym_2029 Enzymes [BR:erc01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      Ecym_2029 Ubiquitin system [BR:erc04121]  Ubiquitin ligases (E3)   UBL E3 ligases    Ecym_2029   Multi subunit Ring-finger type E3    SCF complex     Ring finger protein      Ecym_2029    Cul2 complex      Ecym_2029    Cul3 complex      Ecym_2029    Cul4 complex      Ecym_2029    Cul7 complex      Ecym_2029    Cul8 complex      Ecym_2029    Cul9 complex      Ecym_2029 DNA repair and recombination proteins [BR:erc03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       Ecym_2029     TCR (transcription coupled repair) factors      Cul4-CSA complex       Ecym_2029 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-RING_11 Motif Other DBs NCBI-GeneID:  11470463 NCBI-ProteinID:  XP_003644605 UniProt:  G8JNY8 LinkDB All DBs Position 2:47083..47427 Genome browser AA seq 114 aa AA seqDB search MAEDNMDIDDPVDNAITNSSVEDKPKKFQIKKWTAVAFWSWDIAVENCAICRNHIMEPCI QCQPNAMTDTDNECVAAWGTCNHAFHLHCINKWLLTRNACPLDNKTWQFAKYGK NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atggcggaagataatatggatattgatgatcctgttgataatgcaattaccaattcgtct gttgaagacaaaccgaagaagttccaaattaaaaaatggactgccgttgcattctggtca tgggatatagcagtggagaactgcgccatttgcaggaatcatataatggagccttgtata cagtgccagccaaatgctatgacggatacggataatgagtgtgttgctgcgtggggtaca tgtaatcatgcgtttcatttgcactgtataaataagtggttacttaccaggaatgcctgt ccgttggacaataaaacatggcagttcgcaaagtatgggaagtga

DBGET integrated database retrieval system