KEGG   Eremothecium cymbalariae: Ecym_2551Help
Entry
Ecym_2551         CDS       T02237                                 

Definition
(RefSeq) Hypothetical protein
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
erc  Eremothecium cymbalariae
Pathway
erc00730  Thiamine metabolism
erc00790  Folate biosynthesis
erc01100  Metabolic pathways
Module
erc_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:erc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Ecym_2551
   00790 Folate biosynthesis
    Ecym_2551
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:erc04147]
    Ecym_2551
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:erc00537]
    Ecym_2551
Enzymes [BR:erc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Ecym_2551
Exosome [BR:erc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Ecym_2551
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:erc00537]
 Enzymes
  Ecym_2551
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 11470700
NCBI-ProteinID: XP_003645088
UniProt: G8JQB3
LinkDB All DBs
Position
2:complement(1068369..1069994)
Genome map
AA seq 541 aa AA seqDB search
MLEKGNDYYVADIEANSLVPKKARKRWLVAMKWVVFCIVLRCVFWFAFDYDFMGRYQEAG
SKRNVIFFVTDGMGPASLTLTRGFLQNEKNDTTEMYFSGLGVNSYLVGTSRTRSSSSYIT
DSAAGATAFSCGLKTYNGAVGVDAAQQPCGTVLEAAKLQGYMTGMVVTTRITDATPGAYS
AHVDNRGQEELIAEQQLGGYPLGRVVDLIIGGGRKFFFGSNERKYGGEYGARRDERDLIE
EAVVNGWQYVGDTAQFRELQGGKNVSLPLLALLAHEDLPYSIDRDAERQDWPSFTEQVKT
AVRALTEATKDSDKGFFLLVEASRIDHAGHTNDPGTQAREVMGFDDAFQWTVAHAKNSNV
ETLIISTSDHETGGLSVGRQLDQNEIQYYWDPEVLSRMKHSCDYFGKEIMSFKESNADPA
QLREFVRETVFKDGLGIRDVADSDVNLIVGLDDFAQLVNELGLIVSVRAYIGWSTHGHSG
VDVNVYAYANKMSAKHLIRKNLSGNRENTDIGQFVIDYLSLDVAAVTDMLKDTKHSPDKG
N
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgttggaaaagggtaatgattattatgttgcggatatagaggccaattcgctggttcca
aagaaggctcgcaagcggtggcttgtggccatgaagtgggtggtgttctgcattgtgttg
cgctgtgttttctggtttgcgtttgactatgactttatgggaagatatcaagaggctgga
tcgaaaagaaacgtaatattttttgttacagacggtatggggccggcttcattgacgttg
acaagagggttcttgcagaatgagaagaatgatacaacagagatgtatttcagcgggctt
ggcgtaaacagttatttggtagggacttcgcggacgcgttcgtcgtcttcgtatatcaca
gattcagcggcgggtgccacggcgttttcgtgtggcttgaagacgtataacggggcggtg
ggtgtggatgcagcgcagcagccgtgtggtacggttttggaggcagcgaagctgcaaggg
tacatgacggggatggtggtgactactaggatcacagatgcaactccgggggcgtattct
gcccatgtggataatcggggacaggaggaacttattgcagagcagcaattgggggggtat
cctcttggacgtgtggtggatttgataatcggtggtggtagaaaattcttttttggtagt
aatgagaggaaatatggaggggaatacggagcacgtcgggatgagcgcgatttaatagaa
gaggcagttgttaacggctggcagtacgtcggcgacactgcacaattccgggagttacag
ggcggtaaaaacgttagtcttccattgttggctttgttggctcatgaagacttaccatat
tctatagatagggatgcagagagacaagattggcccagtttcacagagcaagttaagaca
gcagtgagggctttgacagaggctacaaaggactcagataagggtttctttttgctggtg
gaggcctccagaatcgatcatgcaggtcatacgaacgatccagggacccaggctagggag
gttatgggttttgatgatgcctttcaatggactgtggctcacgctaagaattccaacgtt
gaaacattgataatctctacttcagatcatgagactggcggtctctccgttggaagacag
ctagaccaaaatgaaatacaatactactgggatccagaagtattgagtcgcatgaagcac
tcatgcgactattttggaaaggaaattatgagttttaaggaatccaatgctgaccctgcc
caattgagggaatttgttagggagacggttttcaaagatggtcttgggattcgcgatgtt
gcggactcagatgttaacctaatcgtggggttagatgactttgcgcagcttgttaatgaa
ttgggcttgattgtatctgtccgcgcgtatattgggtggagtacccacggtcatagtggt
gtggacgttaatgtttatgcatatgctaacaaaatgtctgccaaacatctaattcgtaag
aacttgtctggtaatcgtgagaatactgatataggccaatttgtcatagattacctatcc
ttggatgtggcagcagttacagatatgcttaaggacacaaaacactcacctgataaagga
aactga

DBGET integrated database retrieval system