KEGG   Eremothecium cymbalariae: Ecym_2558Help
Entry
Ecym_2558         CDS       T02237                                 

Definition
(RefSeq) Hypothetical protein
  KO
K10967  alpha 1,2-mannosyltransferase [EC:2.4.1.-]
Organism
erc  Eremothecium cymbalariae
Pathway
erc00514  Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:erc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    Ecym_2558
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:erc01003]
    Ecym_2558
Enzymes [BR:erc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     Ecym_2558
Glycosyltransferases [BR:erc01003]
 Glycan extension
  Yeast mannan chain
   Ecym_2558
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_transf_15
Motif
Other DBs
NCBI-GeneID: 11471927
NCBI-ProteinID: XP_003645094
UniProt: G8JQB9
LinkDB All DBs
Position
2:1087788..1089002
Genome map
AA seq 404 aa AA seqDB search
MAVNISKRIIRLGLLSSFILLSVVFLSTHSKVNEFIFGSSVASDAVAKGITEGGEKPSIV
DKNASKDLGDYAEHFAGDMESTGDSEGKPKACFVSLVRNEALWDIVPSIQQVEDRFNRNY
KYPWVFLNDVPFTDEFKHVVSNIVSGSVEFGIIPKEHWSYPNWIDQEKAAKARQEMAENN
IIYGGSEPYRHMCRFESGFFWRHPLLKKFNWYWRVEPSTQLYCDIKYDVFKWMQEHKKVY
GFTISIREYEATIKTLWETTKQFMKEYPNYIEKDNMMAFISDDNGKTYNLCHFWSNFEIA
SLDFWRSDRYKTYFEYLDKAGGFFYERWGDAPVHSIAAALMLRKDQIHYFADIGYHHPPY
SNCPADNKLWSEGRCSCNQKNDFTFEGYSCGTKFYEVNGMKRPT
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggcggtcaatatcagcaagaggattatccgattgggtcttttatcttcttttattctc
ttgtcagtggtgtttctatcaacacattcgaaggttaatgagtttatttttggatcaagt
gttgcttctgatgccgtggcgaagggaattacagaaggtggggagaagcctagtatagtt
gataaaaatgcgtcgaaggatttgggtgattatgcagaacattttgctggggatatggaa
tcgactggggattctgaggggaagccaaaggcgtgcttcgtgagcttggttagaaacgaa
gcattgtgggacattgttccttcgatacagcaagttgaggatcgttttaataggaactat
aaatatccgtgggtcttcttgaatgatgttccctttaccgatgaatttaagcatgtggta
tccaacatagttagtggtagcgtggaatttggtattattccaaaggaacactggtcatat
cctaattggattgaccaagaaaaggcagcaaaagcaagacaagagatggcagaaaacaat
attatatatggtggttctgagccatacaggcatatgtgtcgtttcgaatcggggttcttc
tggagacatccactgttaaagaaattcaactggtactggcgtgtggaaccaagtactcaa
ctatattgtgatatcaaatatgatgtattcaagtggatgcaggagcataaaaaggtctat
gggtttaccatttccattagggagtacgaggcaactatcaagacattgtgggaaacaaca
aagcaattcatgaaggaatacccgaattatattgaaaaagataatatgatggcctttatt
tccgatgataatggtaaaacttacaatttatgccatttctggtcaaatttcgagatagca
tcattggatttctggaggagtgataggtataaaacatattttgaatacttagacaaagca
ggcggatttttctatgaacgttggggtgatgctcctgtgcattcaatagctgccgctcta
atgcttcgtaaagatcaaatacattattttgctgatattggctaccatcatccaccttat
agtaactgtcctgcagacaacaaattatggtctgaaggccgttgttcatgcaatcaaaaa
aatgattttacctttgaaggttactcttgcggaacaaagttctacgaggttaatgggatg
aagcgtcctacatag

DBGET integrated database retrieval system