KEGG   Eremothecium cymbalariae: Ecym_2766Help
Entry
Ecym_2766         CDS       T02237                                 

Definition
(RefSeq) Hypothetical protein
  KO
K10246  fatty acid elongase 3 [EC:2.3.1.199]
Organism
erc  Eremothecium cymbalariae
Pathway
erc00062  Fatty acid elongation
erc01040  Biosynthesis of unsaturated fatty acids
erc01100  Metabolic pathways
erc01110  Biosynthesis of secondary metabolites
erc01212  Fatty acid metabolism
Module
erc_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:erc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    Ecym_2766
   01040 Biosynthesis of unsaturated fatty acids
    Ecym_2766
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:erc01004]
    Ecym_2766
Enzymes [BR:erc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.199  very-long-chain 3-oxoacyl-CoA synthase
     Ecym_2766
Lipid biosynthesis proteins [BR:erc01004]
 Elongase
  LCFA
   Ecym_2766
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ELO
Motif
Other DBs
NCBI-GeneID: 11468512
NCBI-ProteinID: XP_003645282
UniProt: G8JQ02
LinkDB All DBs
Position
2:1490491..1491501
Genome map
AA seq 336 aa AA seqDB search
MDQVRQEIMNQVGGLAAKLGSNSIIEVSRPSIDRPFGVHLWPLFSALFKKVTGYPAESFE
FIQGKTFLADGYQGIGVIIAYYATVFGGQAVLRAADVPAVKMNFLFQLHNVLLTVVSFVL
LVLMVEQVVPMLYRHGLFWSICSPGAFTPKLVTLYYLNYLTKYYELLDTVFLVLKRKKLL
FLHIYHHGATALLCYAQLTGHTSIEWVPISLNLAVHVVMYWYYFLSARGISVWWKEWVTR
FQIIQFLIDLCFVYFATYSFYADKYFPDVLPNKGSCNGTEEAAAYGYLILTSYLVLFISF
YVQSYRKGAKTSKKTPVSKQKVPSASKPAKATSRKV
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggatcaggttcggcaagaaataatgaaccaggttggcggtttggctgcgaaattgggg
tccaattcaataattgaagtttctaggccgtctattgataggccgtttggggttcatttg
tggcctttgttttcagctttgttcaagaaagtgacgggctatccggcggaatcttttgaa
tttattcaaggcaagacgtttcttgctgatggttatcagggaatcggtgttattatagct
tattatgctactgttttcggtgggcaggccgttttacgggcagcagatgttcctgctgtg
aagatgaactttttgtttcaattgcataatgtgcttttgacagtagtttctttcgtgtta
ttggttttgatggttgagcaagtggtgcccatgctttataggcatgggttgttttggtcg
atttgctcaccgggtgcctttacacccaagcttgttacactttactatttgaattatttg
accaagtattacgagttgcttgatacggtgtttttggtgctcaagaggaaaaagttgtta
ttcttacatatttatcatcatggggccactgctttgttgtgttacgctcaattgactggg
catacttctattgaatgggttccaatttccctaaaccttgctgtccatgtcgtgatgtat
tggtattatttcttgtcagctcgggggataagtgtttggtggaaagagtgggttactagg
tttcagatcattcaatttttgattgatctctgctttgtctactttgcgacatattcgttt
tatgctgacaagtactttcctgacgttttgcccaataaagggagctgcaatggcacggaa
gaagctgctgcatacggctatttgattctcacgtcctatttggtcttgtttatctccttc
tatgttcaatcgtatcgtaagggagccaagacgtcaaaaaaaacacctgtgagcaagcag
aaggtgccttccgcttccaagcctgccaaggctacttctagaaaggtttag

DBGET integrated database retrieval system