KEGG   Eremothecium cymbalariae: Ecym_3314Help
Entry
Ecym_3314         CDS       T02237                                 

Definition
(RefSeq) Hypothetical protein
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
erc  Eremothecium cymbalariae
Pathway
erc00500  Starch and sucrose metabolism
erc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:erc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Ecym_3314
Enzymes [BR:erc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Ecym_3314
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_15
Motif
Other DBs
NCBI-GeneID: 11468907
NCBI-ProteinID: XP_003645622
UniProt: G8JRN6
LinkDB All DBs
Position
3:605045..606847
Genome map
AA seq 600 aa AA seqDB search
MGKFQKTITSHHSRSHRLVRSPWALTAISFAIIWFFHDAFSSFYPISLRLGNDSSAMRSK
GLEAKTIVTVLDFNNRTVLSIGASNKHIQLNQITPSTISRADFSKWIEEQKEISLENMLT
NIGDSRLNNGLVSTEGVAEGVVVASTSKEHPDYFYQWTRDGAITVNTVVNILVDTPRVNI
TLVGTVLKYINNTYVLQRVQNPSGSFEDDLSGLGEPKFMVDNSQFTGSWGRPQNDGPALR
VITIMNFLNYLKGNNLTLEDAATMYRSYYGTDSLPLTFQNEQELFSKVIYYDLVYIMENW
FKESFDLWEEVIGIHFFTTLCQLKALKLSFLHISNGVFKADVLFLERLQSIIDAVTTFMI
KDSGFLNHNLNFIVETPSILGQRSGLNIGSLIGSILTHDELDFEPSSIGAVPFNIDHPAI
LNVLYEMVKRMSILYPINHGRANLNMGVGLGRYPEDIYNGIGVSEANPWFLATSTAAEMM
YKFVYQHYKSSKDLVIELDNDNWNCAFWSLIFNGLSSISKTEARLIIPFNSPAYHQTMHS
IVSYGDSFLDEVRLHVSEEGEMSEQFNKYTGFLQGARHLTWSYGAFLSSIRWRDKVQNYC
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atggggaaatttcagaaaacaattactagccatcattctaggagtcatagattggtgcgt
tctccatgggccctaacggcgataagttttgcaataatctggttcttccatgatgctttc
agctcattttatccaatcagcttgcggcttggcaatgactctagtgccatgagatcaaaa
ggattggaagcaaagactatagtaactgtacttgacttcaataacaggacagtcttatca
attggcgcatctaacaagcacattcagttgaatcaaataacgcctagtacgatttccagg
gcggatttttcgaagtggatcgaagaacaaaaggagatcagtttggaaaatatgttgacg
aatattggtgattctagattgaataacggattagtttctactgaaggtgttgcagaaggt
gttgtggttgcatctacttccaaagagcatccagattatttttaccagtggactagagat
ggtgctatcaccgttaacactgttgtgaatatattagtagacacaccacgtgtcaacatt
acccttgtaggtacagttttaaagtatatcaacaacacgtatgtgttgcagagggtccaa
aatcctagcggttcctttgaagatgatctatctggcctaggggaacccaagtttatggtg
gataattctcaatttactgggagttggggtagacctcagaatgatggtcctgctttgaga
gtaataactatcatgaatttcttgaactacttaaaagggaataatttaactttggaagat
gctgcaacaatgtacagatcttattatggcacagattcactaccgttgacattccaaaac
gaacaggagttatttagtaaagtgatatactatgatttggtatacattatggaaaattgg
tttaaggagagtttcgatttatgggaagaagtaattggtatacattttttcaccactcta
tgccaattaaaggctttaaaattaagttttttgcatatttcaaatggggtctttaaagca
gatgttttatttcttgagcgattacagtcaattatagatgctgttacaacgtttatgata
aaggacagcggatttctaaaccataatttgaactttattgtcgaaacccctagcattttg
ggccagcgttctggtctaaacattggttcattgattggaagtatcttaacgcacgatgag
cttgactttgaaccatcatcaatcggtgctgtaccatttaatattgatcacccggctatc
cttaatgtattgtacgagatggtaaagagaatgagtattttgtaccctatcaaccacgga
agggctaatctcaacatgggcgtcggtttagggagatatccagaggatatctataatgga
ataggcgtttctgaggccaacccatggtttttagctacctccacggctgcagaaatgatg
tacaaatttgtgtatcaacactataaatcatcaaaagatttggtaattgaattggacaac
gataattggaactgtgcattttggagtctgatattcaatggtttaagttctattagtaaa
actgaagctcggttaattattccatttaatagccctgcataccatcaaacaatgcattct
attgtcagttatggagactcctttttggatgaagtgagactacatgttagcgaagaaggt
gaaatgagcgaacaattcaacaaatataccggatttttacaaggcgctagacatttaact
tggtcgtatggcgcctttttaagtagcattcgctggagagataaagtacaaaactactgt
tga

DBGET integrated database retrieval system