KEGG   Eremothecium cymbalariae: Ecym_4245Help
Entry
Ecym_4245         CDS       T02237                                 

Definition
(RefSeq) hypothetical protein
  KO
K19589  release factor glutamine methyltransferase [EC:2.1.1.297]
Organism
erc  Eremothecium cymbalariae
Brite
KEGG Orthology (KO) [BR:erc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:erc03012]
    Ecym_4245
Enzymes [BR:erc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.297  peptide chain release factor N5-glutamine methyltransferase
     Ecym_4245
Translation factors [BR:erc03012]
 Eukaryotic type
  Release factors
   Ecym_4245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTS DUF938 PrmA Methyltransf_16 Methyltransf_23
Motif
Other DBs
NCBI-GeneID: 11469421
NCBI-ProteinID: XP_003646127
UniProt: G8JTF7
LinkDB All DBs
Position
4:508225..508899
Genome map
AA seq 224 aa AA seqDB search
MLSTPDVKCDYTRIYEPSEDSFLLLDSLEKDKCWLNEKFQKSVSVVCEIGSGSGIVTTFM
MKHGLPNQNSIYLPTDINPWATEAMLATSRNNHCEEGFLAPLRMDLTSGIREGSVDLLVF
NPPYVPAPSVPSIPSDDCPQDKWLDLALEGGEDGMIVTTKLLNKLHDVLSHRGIAYILFC
ARNHPEIVAQGMRSRGWVAEIVEHRKAGWEVLSVYKFYRQTKQL
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgctatctactcctgatgttaaatgcgattatacaaggatatatgagcccagtgaagat
tcatttcttcttctggatagtttagagaaagataaatgttggttaaatgagaagtttcaa
aagagtgtgagtgtagtgtgtgagattggctctggttcaggtatagtgacaacgtttatg
atgaagcatgggctgcctaaccaaaacagcatatatttgcccacagatattaatccatgg
gcgacagaagcgatgttagcgactagtcgtaataatcattgcgaggaaggttttctggct
cctttgagaatggatctgactagtggaatcagagaaggtagtgttgatttattagttttt
aatccaccttatgtccctgcaccatctgtaccgtcaattcccagtgatgattgtccccaa
gataaatggctagacctcgctctggaaggtggtgaagacggtatgattgttactactaaa
ctgttaaataaactacacgacgttctttcccacagaggcattgcatatatattattttgc
gctagaaaccatccagaaattgtagcacaaggtatgcgctctagaggatgggttgcagaa
atagtcgaacacaggaaagcaggttgggaagttttgagcgtttataaattctatagacaa
actaaacaattatag

DBGET integrated database retrieval system