KEGG   Eremothecium cymbalariae: Ecym_4246Help
Entry
Ecym_4246         CDS       T02237                                 

Definition
(RefSeq) hypothetical protein
Organism
erc  Eremothecium cymbalariae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dopey_N
Motif
Other DBs
NCBI-GeneID: 11469464
NCBI-ProteinID: XP_003646128
UniProt: G8JTF8
LinkDB All DBs
Position
4:complement(508900..513981)
Genome map
AA seq 1693 aa AA seqDB search
MSLPLKPLTIDSNSKKLDSKRQKFHQNVQKALQHFDAVTEWADYIASLGKLWKALQSWSP
QFPNVKYYVPFPYQVSRRLASSLSPNLPSGVHLKTLDVYTFIFQKIGLETLGKECNIWIA
GLLPLMSYASISVKSPLVELYEKYLIQLPPSILRLLIKPLIASLFPGVDEESSEFQPIIM
NLLDSLRTNLGDDSLFWQSCFMVMIMHKNRRLGGLVWLTKRLPSLNAVPHLVLKKQESSR
RIDDPTAIDKKQVRDDALSLLLPECKSIVSPEPGLLVRCLITCLEEDNELLIQRGILDLL
LQRIHLHSPVLQTLVTPSDRQLLVITCCKTMLRKDMSLNRRIWNWLLGLASRPQHAEMSS
NNDYFPNYGLISLMNGLSDMLMKEREIPNTFRVCHALMDRWEIGSRIVPTLFTNLMKAAE
KYKHNKQIIKSCSVFFDSIETNVIWGNCYQAMLLHDDYELLEFILNTFNVSNDEEIIVKH
CPLMLLALLNLSFNDSSSEVSRKYWLCRTLINIIPDRAYLPIAQADLAEACESDVNETLN
KITSYYELVTSPLQQTTNDISPPFSGANLALLTTRRVNSLLIKGLKSGQMINEISILFVL
LVEKIPEQPKEDDHDDHDDISVSKFNESYNWSNGGLLQSIFDLKDRMSDSANGDCIFGIV
EIYSNYLASRLNLFDSLKLLKIIIASLWKYLLHPNTQMEAIRCLDSLNRAIDTKSIEGAL
TNAFIQEKDISLKLTALDALWNHLENDIDMIRYPLQLVFDELWDEQRLSYLYASKWVVSV
VSANAGNRLFQVVTDNLLSFQFFARDSLKELDDLDLFTYHVQTVTNILRTQESVVLKAFG
TELTSVQSFENWGDEDISTYKGLTVAVLLKFLNLESNVHGRSIRSVLILLDTLLDGTEQN
FKSIVTRLLNLSTKYMKQSGTESEIIIVSLLNIVSRILSLSHKNGIKLDIFDDQNSHTNY
IDFLVSSITFIESPLVISSYVQLLSQSIVYFQNSIFNVILPLSNSITQCIERLFYEPADK
GANFRAFSLLIDGLEELLEISHGYLVTGENSGYLPSSGTKNDFLQSMVSNVFSNDTTNNK
NKFQGHREVILQSFKRAVDCSFGVWVWAQQHSNPKGTITNMKDIGGQDFSESLHQLSYRY
KFKTKKLIEKLFNLEPLEVLEILISNRRDYLTITLIHVLDGNRPVLTVPHLMQSLLNTCN
KGSTLLFSTVNTTTKRANEPSMAVSKLDASEILGFITEYVHSLENAAMEEFYNDFLMFIK
EISQNPFYYESVNFQVLILISIVSEKIAHCQFGQQKRVRKDLSDISVKYMNTVLSDDVIS
RKCVKDEIFDGLLYIVQRLHHIVNEQIHGDKFNSCVSVMVSFAIIPMIKNNLWEAGEVNS
FLELTLAVAKLGAKVRNWKTLISEIFNDNVKLTQFVEAAPIWNEIIFEWSQYQELQDKLM
NDLILTIAQKGNVITPTINPFQGWSDSEVTLKFKHMAKIAYLLTISPKDTYLLYFKPLMD
QIEDYLFSADAPLKVSCYILLRAIFVHFDQSHLADHWLVITHGLQTGLQAFYESLQIQEP
VDSNLILQLCKSLDLLLVLNFEEFSATNEWIFIIGTINCIYKTDPYMALIDEISECKDYM
TSSVTDVELATRTNERIPLLTDIRTIGSHLELRTFFHNLSYTHYETMYGMKPINFKVLYE
DLKKDVLAVMQVQ
NT seq 5082 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcttccattgaaaccgttgaccatcgactctaactctaagaagttagattcgaaa
cggcagaagtttcaccagaacgtccaaaaggcattgcaacattttgatgctgtaacagag
tgggcagactatattgcaagtctcggaaagctttggaaagctttgcaaagctggtcgcca
caatttccaaatgtgaaatattacgtgccatttccataccaggtaagtagacgtctagca
tcatctctgtcccctaatttaccatctggtgttcatttaaaaactctagatgtttacact
tttatatttcagaaaataggactggagactcttggcaaggaatgcaatatatggatagca
ggtctgttacctttgatgtcttatgcttcaatttctgtgaaatctccattggttgagttg
tatgaaaagtatctaatccagctaccaccctccatactgagattattgataaagccatta
attgcaagcttgtttccaggtgttgatgaagagagcagtgaatttcaaccaatcataatg
aatttacttgattcgttgagaacaaatttgggcgatgactccttattttggcaaagttgt
tttatggtcatgatcatgcataagaatcgtcgccttggtggcttagtatggctaaccaaa
cggcttccatctctcaatgcagttccgcacttagttttgaagaagcaggagtctagtcgc
agaattgatgatcccactgctatagataaaaaacaagtgagagatgatgctctatcatta
ctgcttcctgagtgtaaaagtatagtctctccggagccagggctgttagttcgctgtttg
atcacatgccttgaagaagataatgagttactaatccagcggggaatcctggatctacta
ttacaacgaattcaccttcattcgcccgttttgcaaacattagttaccccttcagacaga
caactattagtaattacttgttgtaaaacaatgttgagaaaggatatgtctctcaatagg
cggatttggaactggttacttggtctagcgtcgagacctcaacatgcggagatgtcttca
aacaatgactacttcccgaattacgggttaattagtttaatgaatggtctatcagatatg
ctcatgaaagaacgtgaaattccgaatacttttagggtgtgtcatgctttaatggatcgg
tgggagataggttcgcgtatagtgccaactttgtttactaacttgatgaaggcagctgaa
aagtataaacataacaaacagatcatcaagagctgttctgtgttttttgactctattgaa
acaaatgttatttggggaaattgctaccaagccatgttacttcatgatgattacgaattg
ttggaatttattttgaatacctttaacgtttccaatgatgaagaaattattgttaaacac
tgtccactgatgcttttggctcttttaaacctgtcatttaatgattcttcatctgaagtg
agtcgaaagtattggctttgcagaacattaattaatataataccagatagagcctatctt
cccattgcacaagctgatcttgcagaagcttgtgaaagtgatgttaatgaaacgctaaat
aaaataacttcctactatgagctggtgactagtccattacaacagactacaaacgatatc
tccccaccatttagcggtgctaacttagctcttttaacaactcgaagagtgaattctctg
ttaataaaaggtttaaaatcgggtcagatgatcaatgagatctccattctgtttgtattg
ttagttgagaagattcctgaacaaccaaaagaagatgatcatgatgatcatgatgatatc
tctgtctctaaattcaacgagagctataattggtctaatggcggtcttttgcaatccatt
tttgatttgaaagatcgtatgagtgattcggcaaatggagattgcatttttggcattgtt
gaaatatattcaaattacttagcctcaaggttaaacctttttgattctttgaagctattg
aaaataatcattgcctctttatggaaatatttacttcatccaaatactcaaatggaagca
attaggtgcttagattcacttaacagagctattgacacaaagtctattgagggggcattg
acaaatgccttcattcaagaaaaagatatttctttaaaattgactgcgttagatgcattg
tggaatcatctagagaatgatattgacatgatcagatatccattacaacttgtttttgat
gaactatgggatgaacaaagattatcatacttatatgcttcaaagtgggttgtctcagtt
gtcagtgctaacgctgggaacaggctgttccaagtcgttacagataacctattgtcgttt
cagttcttcgccagagactcattgaaagagttagacgatttggatctatttacatatcat
gtacaaactgtcacaaatatcttacggacccaagaatctgtcgttcttaaagcatttggt
actgagttaacttctgttcaatcttttgaaaactggggagatgaagatatctcaacttat
aaaggtttgacggtagctgttctcttaaaatttttgaatttagagagcaacgtacatgga
agaagcattagaagtgtactaattttattggatactctactggatgggactgaacaaaac
ttcaaatcaatcgtcacaagattattaaacttgtctactaaatacatgaagcaaagtgga
actgaatcagaaattattattgtgtcattgttaaacattgtttctaggattttatcacta
tcgcataaaaatggcataaagttagatatatttgatgaccaaaattctcataccaactac
atagattttctggtctcgagtatcacatttatcgaatcaccattagtaatttcctcttac
gttcagttactctctcaaagcattgtttacttccagaattcaatattcaacgttatacta
cctctatcaaattccatcacacaatgtattgaaagattgttttatgaaccagctgataaa
ggagcaaactttagagctttttcactattaattgacgggttggaagaactcttggagatt
tcgcatggttatctagtcacaggggaaaacagtggttatttacctagttctggaacgaaa
aatgactttttacaaagcatggtgtctaacgtgttttcaaatgatactaccaataataag
aataaatttcaaggtcatagagaggtaatactccagtcttttaaaagagcagtagattgc
agttttggtgtttgggtatgggctcaacaacattctaacccaaaggggacgattaccaac
atgaaagatattggaggtcaagattttagtgaatctttgcatcagctttcttacagatat
aaattcaaaacaaagaaattgatagaaaagttattcaacctagaaccacttgaagttttg
gaaatactgatatctaacagaagagattatttgacaatcacattgatccatgtactcgat
ggaaatagacctgtgctaacggttcctcatttgatgcaaagtctgctaaatacgtgcaat
aaaggctcgaccttactattttcgaccgtaaacacaacaacaaagagagcaaatgaacca
tctatggctgtatccaaattggatgcatcggaaatcttgggctttatcactgaatatgtg
catagcttagaaaatgcagctatggaagaattttacaatgacttcctgatgttcataaaa
gagatatcccaaaatcccttttattatgaatctgtgaactttcaggttttgattttgata
tctattgtgtccgagaaaattgctcactgtcaatttggtcaacagaaacgagtaagaaaa
gatctttctgatatctctgtgaagtatatgaacacagtcctatctgatgatgttatttca
aggaaatgtgtgaaagatgagatatttgatggtcttttgtacattgtgcaaagactacat
catattgtaaatgagcagatacatggggacaaatttaattcttgtgtctctgttatggtt
tcattcgctattataccaatgatcaagaataatttatgggaggccggtgaagtcaattct
ttcttggaactaacattggcagtagcgaaattaggcgctaaagttagaaattggaaaact
ttgattagtgaaatctttaatgataatgtgaagttaacccaatttgtcgaagctgctccc
atatggaatgaaattatctttgaatggagtcaatatcaagaacttcaagataagctgatg
aacgatctaattttaactattgcacaaaaaggtaatgtcataacaccaacaattaaccca
tttcaaggatggtctgattctgaagttactttgaaattcaaacatatggcaaagattgca
tatttgttaacgatatctccaaaggatacatatctgttgtattttaagccattgatggat
caaattgaagattacttgttcagtgctgatgctccactgaaggtaagttgttatatattg
ctaagggctatatttgtgcacttcgatcaatcacatttggctgatcattggttggtaatt
acacatggtctacaaacagggttacaggcattttacgaaagcctacaaattcaggaacca
gtcgattctaatttaattctacaattgtgcaaaagcttggatctgttgctggtcctcaac
tttgaagaattcagtgcaactaatgaatggattttcattattggtaccattaattgtatt
tacaaaaccgatccatacatggcgttaattgatgaaatcagtgaatgcaaagactatatg
acaagctctgtgaccgatgtggagttggccaccagaaccaacgaaaggatcccgttatta
accgatattcgaaccattggaagccacctagaattaagaaccttctttcataatttaagt
tacactcactacgaaaccatgtatgggatgaaacctatcaactttaaagttctttatgaa
gacttaaaaaaagatgtattagccgttatgcaggtacagtaa

DBGET integrated database retrieval system