KEGG   Eremothecium cymbalariae: Ecym_4249Help
Entry
Ecym_4249         CDS       T02237                                 

Definition
(RefSeq) hypothetical protein
  KO
K13341  peroxin-7
Organism
erc  Eremothecium cymbalariae
Pathway
erc04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:erc00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    Ecym_4249
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: WD40
Motif
Other DBs
NCBI-GeneID: 11472496
NCBI-ProteinID: XP_003646131
UniProt: G8JTG1
LinkDB All DBs
Position
4:complement(516064..517188)
Genome map
AA seq 374 aa AA seqDB search
MLIGYHMKGYSGYAVQYSPFFDNKLAVATGSNFGLVGNGKLFILDITPQGKIVESNSFLT
KDGLFDVAWNELHENQVLAAQGDGSLRLFDINLQKYPVAIFQEHEREVFSCNWNLIDKQT
FLSSSWDGTVKIWSPARKQSLRTLLPTPTNNTVLVDSTVLKQDVPVSNQAQHKYSSNNKD
CIYQALYSPHDSNLVMSCSGNSYVSIFDIRQPVNTEQQSFIAHRGLEALTCDFNKYRPHI
VATGGVDKLIKVWDLRMVRQSLLHTRSSPVSINEMQGHSLAVRRVFWSPHHSDMLLSTSY
DMTCRTWQDLTDNNTSGYTPGRTNNSHPQRGCQFSFENHSEFVFGADWSLWGEPGYVATT
GWDGHVYAWYAFPR
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgttgattgggtatcatatgaaaggctacagtggctatgcggttcaatattctccattc
tttgataacaagcttgcggtcgccacgggttcaaactttggactagtcgggaatggaaaa
ctattcatattggatataactccccaaggtaaaattgtcgaaagcaattccttcttaact
aaagatgggctttttgatgtagcctggaatgaactacatgaaaaccaagttctcgctgcg
caaggggatggatctctaaggttattcgatattaacctgcagaagtatcccgtggccata
tttcaggaacatgaacgtgaagtattcagctgtaattggaatttgatagataagcaaact
tttctaagctcttcatgggatggtactgtgaaaatctggtcaccggctagaaagcaaagt
ttgcgaaccctgcttcccactcctacaaataatactgttttagtcgatagcactgttttg
aaacaagatgttcctgtgtctaatcaggctcaacataaatattcatcaaataataaagat
tgcatataccaagcgttgtattctccacatgattcgaacctagttatgagttgttctggt
aattcatatgtttccatctttgatattagacagcctgtaaacactgagcagcaaagcttc
attgcacatagaggtttagaggcgctaacttgtgactttaataaatacagacctcacatt
gttgccactggtggtgttgataaacttattaaagtctgggatctaaggatggtaagacaa
tcgctcttgcatactagatcatctcctgtgagcatcaatgagatgcaaggtcattcattg
gctgttcgcagagtattctggtcaccacatcactccgatatgctgctgtctacttcatat
gatatgacatgtcgtacgtggcaagatttaactgacaacaatactagcggttatactcca
ggccgaacaaataacagtcaccctcaaagaggttgtcagtttagttttgaaaatcatagc
gaatttgtattcggtgcagattggagcctatggggtgaacctggttatgttgcaaccact
ggttgggatggacatgtttatgcatggtatgcatttccaagataa

DBGET integrated database retrieval system