KEGG   Eremothecium cymbalariae: Ecym_6001Help
Entry
Ecym_6001         CDS       T02237                                 

Definition
(RefSeq) hypothetical protein
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
erc  Eremothecium cymbalariae
Pathway
erc00010  Glycolysis / Gluconeogenesis
erc00051  Fructose and mannose metabolism
erc00052  Galactose metabolism
erc00500  Starch and sucrose metabolism
erc00520  Amino sugar and nucleotide sugar metabolism
erc01100  Metabolic pathways
erc01110  Biosynthesis of secondary metabolites
erc01130  Biosynthesis of antibiotics
erc01200  Carbon metabolism
Module
erc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
erc_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:erc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ecym_6001
   00051 Fructose and mannose metabolism
    Ecym_6001
   00052 Galactose metabolism
    Ecym_6001
   00500 Starch and sucrose metabolism
    Ecym_6001
   00520 Amino sugar and nucleotide sugar metabolism
    Ecym_6001
Enzymes [BR:erc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     Ecym_6001
Membrane trafficking [BR:erc04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    Ecym_6001
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 FGGY_N
Motif
Other DBs
NCBI-GeneID: 11469273
NCBI-ProteinID: XP_003647226
UniProt: G8JUT0
LinkDB All DBs
Position
6:4872..6332
Genome map
AA seq 486 aa AA seqDB search
MVHLGPKKPPARKGSMADVPRTLMEQLANFEQLFSVSPERLRIITDHFVGELQKGLTKKG
GNIPMIPGWVMDYPTGKETGNYLAIDLGGTNLRVVLVTLGGNHDFDTTQSKYKIPSHIRT
TQNHEELWMFVAESLKAFLEDQFPDGVKENFPLGFTFSYPASQDKINEGILQRWTKGFDI
PNVEGQDVVPMLQKCLNDINLPIKVTALINDTIGTLVASLYTDAETKMGVIFGTGVNGAY
YDVCSNIEKLEGRLPGDIPADSPMAINCEYGSFDNEHLVLPRTKYDILVDEQSPRPGQQA
FEKMTSGYYLGELLRLVLLDVYAQGLIFQGQNITKLEEPYIMDTSYPSRIEEDPFENLDD
TDDLFRNDFGIETTLPERKLIRRLSEYIGVRAARLSVCGIAAICKKRGYETAHIAADGSV
YNKYPDFRNRAMSGLRDIYDWPLSATNDYPITLVAAEDGSGAGAAIIAALTQKRLAEGKS
VGVMDH
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggttcacttaggcccaaagaaaccaccagccagaaaaggttccatggcagatgtgcca
agaaccttgatggaacagcttgctaactttgaacagctatttagcgtttctcctgagagg
ttaaggattatcacagatcattttgttggcgaattgcaaaaagggttgactaagaagggc
ggcaatatcccaatgattccgggctgggttatggactacccaactggtaaagaaactggt
aactatttggctatcgacttgggtggtactaatctgagggtagttttggttaccctaggt
gggaatcacgacttcgacaccacccaatccaaatataagataccatcgcatatcagaact
acccagaaccacgaagaactatggatgttcgttgctgagagtttgaaagctttcctcgaa
gatcagttcccagatggtgtgaaggaaaattttcctctagggttcaccttctcttaccct
gcctctcaggataagattaatgagggtattttgcaaaggtggacaaagggtttcgatatc
ccaaatgttgagggtcaggatgttgtgccaatgttacagaagtgtttgaatgacataaat
ttaccaattaaggttaccgcgttgatcaacgatactattggtaccttggttgcgtctttg
tacaccgatgctgaaaccaagatgggtgttatctttggtactggtgtgaacggtgcgtac
tatgatgtatgttctaacattgaaaagttagaaggtaggttgccaggtgatattcctgct
gattctcctatggcgatcaactgtgagtatggttcttttgacaacgagcaccttgtgttg
ccaagaactaagtacgatattctggttgacgaacagtccccaagaccaggtcaacaagca
tttgagaagatgacctcgggttattatttaggtgaattgttgcgtttggttctattggac
gtttacgcccagggtttgatattccaaggacaaaatataaccaaattagaagagccatac
attatggacacatcctacccatccagaattgaggaggatccatttgagaacttggatgat
actgatgacttgttcaggaatgattttggtatcgaaacaacattgccagaacgtaagcta
atcagaaggctctctgagtacattggtgtaagagctgccagattgagtgtctgtggtata
gctgctatctgcaagaagagaggttatgagactgctcacattgctgctgacggttctgtt
tacaacaagtatcctgatttcaggaacagagcaatgagtgggttgagagatatttacgac
tggcctctgtctgcgacgaacgattatccaatcactcttgtcgctgcggaggatggttct
ggtgccggtgccgcaattattgctgctttgacacaaaagagattggcagaaggcaagtct
gttggtgttatggaccactaa

DBGET integrated database retrieval system