KEGG   Eremothecium cymbalariae: Ecym_6056
Entry
Ecym_6056         CDS       T02237                                 

Definition
(RefSeq) hypothetical protein
  KO
K12766  serine/threonine-protein kinase MDS1/RIM11 [EC:2.7.11.1]
Organism
erc  Eremothecium cymbalariae
Pathway
erc04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:erc00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    Ecym_6056
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:erc01001]
    Ecym_6056
Enzymes [BR:erc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Ecym_6056
Protein kinases [BR:erc01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   Ecym_6056
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Choline_kinase RICTOR_M
Other DBs
NCBI-GeneID: 11468811
NCBI-ProteinID: XP_003647276
UniProt: G8JUY0
LinkDB
Position
6:complement(107449..108888)
AA seq 479 aa
MQQSEVRDGQQQQQHAETMDITHITNPTVTKQVYKGHSRRTGAGAANSNNHHGNRTGNNE
NHSHNSNIHIYNNGKGNNNNNNSNNSNSNNNGSSNGGQESGGGAETQTEAEEELVEITYP
ATEVVGHGSFGVVFTTVIEQTGEKVAIKKVLQDKRFKNRELEIMKLLEHVNVVDLRYHFY
ESEPQTNEVYLNLILEYMPQSLYQRLRHFVTSRTLMPRDEIKVYMFQLFKSLNYLHRVAR
VCHRDIKPQNLLVDAESLQLKLCDFGSAKQLKPTEPNVSYICSRYYRAPELIFGATNYTT
QIDIWSTGCVMAELLLGQPMFPGESGIDQLVEIIKILGTPTRPEICAMNENYSDHKFPQI
KPIPLSKVFKREDPETVQLLNDVLQYDPTKRFNALLALCSSYFDDITCLARGDTETTTTT
TTTTASGARGGASNAPAELWQGICHNLQLMQFAADEFNDLNDLEKSLVQSKLILHTRSD
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgcagcagtcggaagtccgagatgggcagcagcagcagcagcacgccgaaacaatggac
attactcacattactaatcccacagtgaccaaacaggtctacaaaggacacagcagaagg
acgggggccggggcggccaatagcaacaatcaccatggtaaccgtacggggaacaatgag
aaccacagtcacaatagtaacattcatatttataataatggtaagggtaataataataac
aataatagtaataatagtaatagtaataataatggtagcagtaacggggggcaggagagc
ggcggtggtgcggagacgcagacggaggccgaggaggagttggtggagatcacgtacccg
gccacagaggttgtcgggcacgggtcgtttggggttgtgtttacgacggtgatagagcag
accggggagaaggtggcgatcaagaaggtgctgcaggacaagaggtttaagaaccgggag
ttggagattatgaagcttctagaacatgtgaacgtggtggatctgcgctaccatttctac
gagagcgagccgcagacgaacgaggtatatttgaatttgattctggagtacatgccgcag
tcgttgtatcagcggctacggcattttgtgacgagccggacgctgatgccacgtgacgag
atcaaggtttacatgttccagctgttcaagtcgctcaactatctgcaccgggtggcgcgg
gtgtgccatagggacatcaagccgcagaatctgctggtggacgcggagagtttgcagctc
aagctgtgcgactttgggtcggcgaagcagctgaagccgacggagcccaatgtgtcatac
atttgctcgcggtactacagggcgccggagttgatattcggtgctacgaactataccacg
cagatcgatatctggtccacggggtgtgtgatggcggagttgcttctggggcagccgatg
ttccctggggagtcggggatcgaccagttggtcgagattatcaagattttgggcacgcct
acgagaccggagatctgtgcgatgaatgagaattactctgaccacaagttcccgcagatc
aagcccattccgctgagcaaagttttcaagcgcgaagacccggagaccgtgcagctgcta
aacgatgtgctgcagtatgaccccacaaaacggttcaatgctttactggcattgtgcagt
tcctattttgatgacattacttgcctcgctcggggcgatacggagacgacgacgacaacg
acgacgacgacagccagcggtgcaagaggtggcgcttctaacgcgcctgcagaactctgg
caaggtatatgccacaatttgcaattgatgcagttcgctgctgatgagtttaacgatttg
aacgacctggaaaaatccttagtacaatctaagttgatactacacactcgctcagattga

DBGET integrated database retrieval system