KEGG   Eremothecium cymbalariae: Ecym_7211Help
Entry
Ecym_7211         CDS       T02237                                 

Definition
(RefSeq) hypothetical protein
  KO
K07975  Rho family, other
Organism
erc  Eremothecium cymbalariae
Brite
KEGG Orthology (KO) [BR:erc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:erc04031]
    Ecym_7211
GTP-binding proteins [BR:erc04031]
 Small (monomeric) G-proteins
  Rho Family
   Others
    Ecym_7211
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ras Roc Arf
Motif
Other DBs
NCBI-GeneID: 11469455
NCBI-ProteinID: XP_003647875
UniProt: G8JW43
LinkDB All DBs
Position
7:442765..443412
Genome map
AA seq 215 aa AA seqDB search
MSYQGGVNIRKKLVIVGDGACGKTCLLVVFSKGQFPEIHVPTVFENYVADVDIDGRHVEL
ALWDTAGQEDYDRLRPLSYPDSNVVLICFSVDLPDSLDNVQEKWISEVLHFCQGVPILLI
GCKIDLRNDPQVIDQLHTAGQRPVTAAEGKEVAEKIGAVGYLECSARTGEGVREVFDAAT
RASLAGHPSSATPSSKKKTHSERKSLKKRKKCIIL
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgtcataccaaggaggcgtgaatatcagaaagaaattggtgatagttggggatggtgca
tgtggaaagacgtgccttttggttgtattttcgaagggccaatttcccgagatacatgtg
cccacagtttttgaaaactacgtggcggatgttgatattgatggacggcatgttgaacta
gcgttatgggatactgctggtcaagaagattacgacaggttacggccactttcatatcct
gattcaaatgttgtgttgatctgtttttccgtggaccttccagattcgttagataatgtt
caagaaaaatggattagtgaagtgcttcatttctgtcaaggggttccaatcctactcatt
gggtgtaagatagatctgagaaacgacccccaagtcatagaccagttacatacggcaggt
caaagacctgtaactgctgctgaaggcaaagaagttgccgagaagatcggcgctgtaggt
taccttgagtgctctgctagaacaggagaaggtgtcagagaagtttttgacgctgcaacc
agagcttccctggctggccaccccagttctgctactccatcttctaaaaagaaaactcat
tcggagaggaaaagcctgaaaaagagaaaaaaatgtatcatcttataa

DBGET integrated database retrieval system