KEGG   Eremothecium cymbalariae: Ecym_8248Help
Entry
Ecym_8248         CDS       T02237                                 

Definition
(RefSeq) Hypothetical protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
erc  Eremothecium cymbalariae
Pathway
erc00020  Citrate cycle (TCA cycle)
erc00190  Oxidative phosphorylation
erc01100  Metabolic pathways
erc01110  Biosynthesis of secondary metabolites
erc01130  Biosynthesis of antibiotics
erc01200  Carbon metabolism
Module
erc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
erc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
erc_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:erc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Ecym_8248
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Ecym_8248
Enzymes [BR:erc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Ecym_8248
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Thi4 Pyr_redox_2 FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 11472726
NCBI-ProteinID: XP_003648348
UniProt: G8JXF7
LinkDB All DBs
Position
8:complement(507473..509446)
Genome map
AA seq 657 aa AA seqDB search
MLLSLRQSASALRRCSPRLAAQPGSQVGSQVGQRPRGLASASPGAGAAAAAAEADSSSRH
GQYHIVDHEYDCIVVGAGGAGLRAAFGLAEAGFKTACISKLFPTRSHTVAAQGGINAALG
NIHKDDWKWHMYDTVKGSDWLGDQDAIHYMTREAPDSIIELEHFGMPFSRTEEGRIYQRA
FGGQSKEFGKGGQAYRTCAVADRTGHAMLHTLYGQALNHSTHFFIEYFALDLLTHNGEVV
GVIAYNQEDGTIHRFRAHRTVLATGGYGRTYFSCTSAHTCTGDGNGMVSRAGFPLQDLEF
VQFHPSGVYGSGCLITEGARGEGGFLVNSEGERFMERYAPTAKDLACRDVVSRAMTMEIR
EGRGVGPQKDHIYLQLHHLPASVLKERLPGISETAHVFAGVDVTKEPIPVLPTVHYNMGG
VPTRWNGECLTVDQETGEDKVIPGLLACGEAACVSVHGANRLGANSLLDLVVFGRAVAHT
ISDTLQPGLPHKPVPADLGQESIANLDKLRTATGPLSTSTIRLNMQKTMQNDVSVFRTEE
SLQAGLRNILEVDSTFVDVGTTDRSMIWNSDLVETLELQNLLTCATQTAASAVARKESRG
AHAHEDYPDRDDENWMKHTLSWQRGSGDPVEIKYRNVIATTLDEAECAPVPPTVRAY
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgttattatctctcagacaatcggcatcggctcttcgtcggtgctcgccccggctggct
gcccagccgggcagccaggtgggcagccaggtgggccagcgccccaggggacttgcttcc
gcaagccccggcgccggcgcggctgcggccgctgcggaggcagactccagcagccgccac
ggccagtaccacattgtggaccacgagtacgattgcatagtggtgggcgcaggaggagcc
gggctaagagccgcgtttggcctggccgaggcaggcttcaagacggcgtgtatctccaag
ctgttccccacgagatcgcacacggtggcggcgcagggcggtatcaatgcagcgttaggc
aacatccacaaggacgactggaagtggcacatgtacgacaccgtcaagggctcagactgg
ctaggagaccaggatgcgatccattacatgacacgtgaggcgccggattcgatcatcgag
ctggagcatttcggtatgccgttttcgcgcacggaggaagggcgtatttaccagcgggcg
ttcggcgggcagtccaaggagttcggcaagggcgggcaggcgtaccggacgtgcgcggtt
gcagaccgcacagggcatgccatgctgcacacgttgtacgggcaggcgctgaaccacagt
acgcattttttcattgagtattttgcgcttgatttgctgacgcacaacggggaggtggta
ggagtcatcgcatacaaccaggaggacgggacgatccatcggttccgtgcgcatcgcacg
gtgttggccacaggcgggtatgggcggacgtatttttcgtgcacgtccgcgcacacgtgc
acgggtgacggcaacgggatggtgtcacgtgccgggttcccgctgcaggacctggagttt
gtgcagttccatccgtccggcgtgtacgggtccgggtgtctgatcacggagggcgcacgt
ggcgagggagggttcctcgtgaactccgagggcgagcggttcatggagcggtacgcgcca
accgcgaaggacctggcgtgccgcgatgttgtttcgcgtgcgatgaccatggagatccgc
gagggccgtggtgtagggccgcagaaggaccacatatatctgcagctgcatcatttgcct
gcgtctgtgttgaaggagcgtctgccgggcatttccgagaccgcccacgtgtttgcgggt
gttgatgtgaccaaggagcccattcctgttctgcctacggtgcactacaatatgggaggc
gttccaactcgttggaacggcgagtgcttaacggtcgaccaagaaaccggcgaggacaag
gttattccggggctgttggcgtgtggcgaggctgcgtgtgtttctgtgcatggcgcaaac
cggctgggcgctaattcgctgttggatctggttgtgtttggacgtgctgtggcgcacacg
atcagtgatacgctgcagccggggctgccacacaagccggtgcccgccgatctggggcag
gaatccattgccaatctggacaagctgcgcacggccacgggcccgctgtccaccagcacc
atccggttgaacatgcagaagacaatgcagaacgatgtgtctgtgttccgtacagaggag
tctttgcaggcggggctgcgcaacattctggaggttgactcgacgtttgtggacgtgggg
accacggaccggtctatgatctggaacagcgatcttgtggagacgctggagctgcagaac
ctgctgacatgtgctacgcagacggctgcgtctgcggtggcgagaaaggagtcacgtggt
gcgcatgcccacgaggattacccggaccgagacgatgagaactggatgaaacatacgctg
tcgtggcagaggggatctggagatcccgttgagatcaagtaccgtaatgttattgcaact
actcttgatgaagccgagtgtgctccggtgccccccacggtgagggcttactga

DBGET integrated database retrieval system