KEGG   Eremothecium cymbalariae: Ecym_8290Help
Entry
Ecym_8290         CDS       T02237                                 

Definition
(RefSeq) Hypothetical protein
  KO
K11484  histone deacetylase HOS3 [EC:3.5.1.98]
Organism
erc  Eremothecium cymbalariae
Brite
KEGG Orthology (KO) [BR:erc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:erc03036]
    Ecym_8290
Enzymes [BR:erc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     Ecym_8290
Chromosome and associated proteins [BR:erc03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     Ecym_8290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hist_deacetyl SelP_N
Motif
Other DBs
NCBI-GeneID: 11469960
NCBI-ProteinID: XP_003648386
UniProt: G8JXJ5
LinkDB All DBs
Position
8:complement(589795..591924)
Genome map
AA seq 709 aa AA seqDB search
MPQLDPLHKFKKQFEQFIENNPNVKSAARSASQIPESAKAVIILSPLSLQHRFSRNWVSK
SYKKTIVERPERLLASCMGIAAAITMYPALFTLKSSDNRQSSLLSSHVLKVHGSDWPKEL
LRLCRGAKEKIGRKQVEVPDEWNVGDIYLCEETVYALRGSIGAVEYGVDSIFKGEVNKDT
ANRAFVAIRPPGHHSHAATPSGFCLLNNAHIAVEYAADTYGVTHAVILDFDLHHGDGTQD
ICWKRAGFKADDIQDAKGEYNEFDKKFAEFPKVGYFSMHDINSFPTELNYASKDKVKDAS
TCIMDAHDVNIWNIHLLPYETEEEFNKLYQTRYRTLFAKADEFFKAAKLSMAKDGKPFKG
LVVMSAGFDASEYEQVSMQRHGVNVPTSFYSTFTKDALKLAQMHTNGKIISLLEGGYSDA
AIASGVFSHLIGLQNQNWITEWGSAQVVKEIVRGCKPRWKPYKTRKAGDVIRIWAEEVIR
LGRSMITEFEELLFSDGLVSDFNVPRVTRSRHSEVVAKLELQDASSLPRSDTPTPKERKS
ASAGSNNTNGSTTTKQVPFVEQDLINGTDDEDDENYVYDEELNKTFNRTVEDIAIDDISR
HLETLELVQEFAERPKEPIRARPATQPQHNHDHQQQHHHHHQQAANYQRTNATAPGGYRV
PSNDTTRHLRNSRTSKFLNIEDSDISMISNVSPSKKHFIRGGSSGRYKS
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atgccacaacttgatcctcttcataagtttaagaagcaatttgagcagtttattgagaat
aatccaaatgttaagtcggcagcaaggtcagcgtcgcaaattcctgagtcagccaaggct
gtgattattttgtcaccgctatccctccagcatcggttttcaagaaattgggtatctaaa
tcttataagaaaacgattgtggagaggcctgagcggttgttggcttcttgtatgggcatt
gcagctgcgattactatgtatcctgcgctatttacgttgaaatcttcagataatcggcaa
tcatctttattgtcgtcacatgttttgaaggtgcatggtagtgattggccgaaggagttg
ctacggctgtgccggggggcaaaggagaagattggtaggaaacaggtggaggtgcccgat
gagtggaatgtgggtgatatatatctttgtgaggagactgtgtatgcattgcgtgggtct
attggggcggttgagtatggggttgattctatttttaagggggaagtcaataaagacaca
gctaacagggcgtttgttgcaataagaccaccgggccatcattcgcatgcggcgacgccc
tctgggttttgtcttttgaataatgcgcacattgctgtagagtatgctgctgacacctat
ggcgtcacgcatgcggtgattttggatttcgatcttcatcatggtgatggcacacaggat
atttgctggaagcgtgctgggtttaaggcagacgacattcaggatgcaaagggggaatat
aatgagtttgataagaaatttgccgagttccccaaagtgggttatttttccatgcatgat
ataaattcgttccccacagaacttaattatgcgtcaaaggataaagttaaagatgcgtcg
acgtgcatcatggacgcccatgatgtcaacatatggaacatacatctactgccgtatgag
acggaggaggagtttaataagctatatcaaaccaggtaccgaactctttttgccaaagcg
gatgagtttttcaaggccgctaaactcagcatggccaaagatgggaaaccgtttaagggc
ttggttgtaatgagcgctggctttgacgcttccgaatacgaacaagtctccatgcagagg
catggagtaaacgtgccaacctcgttctacagcacttttaccaaggatgcgttgaaacta
gcgcagatgcacacgaatggtaagatcatatcgttacttgaaggtggatattccgatgct
gctattgcatcaggtgtcttttcccacttgattggtttgcagaaccaaaactggatcaca
gaatgggggtctgcgcaggttgtcaaggaaattgtacgtggctgcaagcctcgttggaag
ccttataaaacgagaaaggctggcgatgtgattcgtatatgggcggaagaagttatccgg
ttgggcagaagtatgatcacagaatttgaggagttactgttcagtgatggactggtatct
gatttcaatgttcccagagtgactcgttccaggcattcggaagtggtggctaagttggaa
ctgcaagatgccagtagcctcccgcgttcggatactccgactcctaaggaaaggaagagc
gcaagtgcaggctccaacaacaccaatggctcaacaacaaccaaacaagttccgtttgtt
gagcaggatctcataaacggcacagacgatgaggacgatgagaactacgtctacgatgaa
gaattaaacaaaactttcaaccgcactgttgaggatattgcgatagacgacatatcgaga
cacttggaaaccttagaattggtccaagagtttgctgaaaggcccaaggaacccatccgt
gctcgtccagcaacccaaccacaacacaaccacgaccatcagcaacaacaccaccaccac
caccaacaagcggctaattaccaaaggacaaatgccactgcgccggggggatacagagtc
ccatcaaacgacaccacccgccatctaagaaacagcaggacatcaaagtttctcaatatc
gaagatagcgatatctccatgatttcaaatgtttccccctccaaaaagcattttataagg
ggtggcagtagtggcagatacaaatcctag

DBGET integrated database retrieval system