KEGG   Eremothecium cymbalariae: Ecym_8411Help
Entry
Ecym_8411         CDS       T02237                                 

Definition
(RefSeq) Hypothetical protein
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
erc  Eremothecium cymbalariae
Pathway
erc00020  Citrate cycle (TCA cycle)
erc00190  Oxidative phosphorylation
erc01100  Metabolic pathways
erc01110  Biosynthesis of secondary metabolites
erc01130  Biosynthesis of antibiotics
erc01200  Carbon metabolism
Module
erc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
erc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
erc_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:erc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Ecym_8411
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Ecym_8411
Enzymes [BR:erc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Ecym_8411
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_7 Fer4_9 Fer4_18
Motif
Other DBs
NCBI-GeneID: 11471560
NCBI-ProteinID: XP_003648497
UniProt: G8JXV6
LinkDB All DBs
Position
8:861407..862198
Genome map
AA seq 263 aa AA seqDB search
MVFRSGFGRVLSRGLATEVGVGGSGSVGRFKTFKIYRWNPDKPAEKPRLQSYDVNLDECG
PMVLDALIKIKNEQDSTLTFRRSCREGICGSCAMNINGRNTLACLCKIDQDERKNLKVYP
LPHMYVVKDLVPDLTNFYKQYKSVQPYLQRTAKPADGKENLQSIDDRKKLDGLYECILCA
CCSTACPSYWWNNEQYLGPAVLMQAYRWIIDSRDEATAKRKDMLQNSMSVYRCHTIMNCT
KTCPKGLNPGRAIAEIKKALATS
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggttttcaggtcagggtttggacgtgtgctaagtagaggtcttgccacagaagtgggc
gtgggggggtcaggatcggtaggtcgtttcaagacattcaagatatacagatggaatccg
gacaagccggcagagaagcctaggttgcagagttatgatgtgaatttggatgaatgtggg
ccgatggtgttggatgctttgattaagatcaagaatgagcaagattcgacgttaactttc
cggaggtcgtgcagggaggggatttgtgggtcatgtgctatgaatatcaatgggaggaac
actttggcgtgtttgtgcaagattgatcaggatgagcggaagaacttgaaggtttatccg
ttgccgcatatgtatgttgtgaaggatttggtgccggatttgacgaatttctacaagcag
tacaagtctgtgcagccttatttgcagcgaacagcgaagcctgctgatgggaaggagaat
ttgcagagtattgacgaccgtaagaagttggacgggttgtacgagtgtattttgtgtgcg
tgctgttctacggcgtgtccctcgtactggtggaataatgagcagtacttaggacctgct
gtgttgatgcaggcgtatcggtggattattgattcgagggatgaggcgactgctaagcgt
aaagatatgttgcagaactcgatgtccgtgtacagatgtcacacaattatgaactgtaca
aagacgtgtccaaagggtttgaatcctgggcgtgctattgctgagattaagaaggcttta
gcgacgtcctag

DBGET integrated database retrieval system