KEGG   Eubacterium rectale ATCC 33656: EUBREC_1357Help
Entry
EUBREC_1357       CDS       T00909                                 

Definition
(GenBank) chaperonin, 33 kDa
  KO
K04083  molecular chaperone Hsp33
Organism
ere  Eubacterium rectale ATCC 33656
Brite
KEGG Orthology (KO) [BR:ere00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ere03110]
    EUBREC_1357
Chaperones and folding catalysts [BR:ere03110]
 Heat shock proteins
  HSP33
   EUBREC_1357
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33
Motif
Other DBs
NCBI-ProteinID: ACR75117
UniProt: C4Z899
LinkDB All DBs
Position
1228832..1229698
Genome map
AA seq 288 aa AA seqDB search
MSDYIVRATAADANIRAFAVTSKEMVENAREDHMTTPVMTAALGRLLSAGAMMGAMMKGD
KDIITLQIQCSGPAKGLTVTADSHGNVKGFAMNPQVELPLNAAGKLDVGGALDLGILTVI
KDMGLKEPYSGQCELKTGEIAEDLTYYFATSEQIPSAVGLGVLVDKDQSVKQSGGFIIQL
MPFTPEDVVDRLEKKITEIDSVTQMLDRGLTPEQILEEILGDFGLEITDTTETRFHCDCS
KERVSRALSTLSKKDLDSIIADGESIEVKCQFCNKAYEFTVDELKEMR
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgtcagattatatagtaagagcaacagcggcggatgccaatatcagagcatttgctgta
acatcaaaggagatggtggagaacgccagagaggatcacatgacaacacctgtcatgacg
gcggcacttggcagactcctttctgcgggagccatgatgggagctatgatgaagggcgat
aaggatatcataactcttcagatacagtgcagcggacctgcaaagggacttaccgtcaca
gcagattcgcacggcaatgtaaagggctttgccatgaatccacaggttgagctgccactc
aatgcggcaggcaagctcgatgtgggaggagcgcttgatcttggtatacttacagtcata
aaggatatgggcttaaaggagccgtattcaggtcagtgtgagcttaaaacaggtgagata
gctgaggatctgacttattattttgccacatctgagcagattccgtcggcggttggtctt
ggcgtgctggtggataaggaccagagcgtgaagcagtccggtggatttatcatccagctt
atgccgtttacaccggaggatgttgtggacaggcttgaaaagaaaatcacagagattgat
tctgtgacacagatgcttgacagggggctgactccggagcagatacttgaggaaatttta
ggggatttcgggcttgaaatcacagatacgacagagacacgcttccactgtgactgttca
aaggagcgtgtgagcagagcactttccacacttagcaaaaaggatcttgattccattatc
gcagatggcgagagcattgaggtaaagtgccagttctgtaataaggcatatgagtttacg
gtggatgagttgaaggagatgcgctaa

DBGET integrated database retrieval system