KEGG   Eubacterium rectale ATCC 33656: EUBREC_1410Help
Entry
EUBREC_1410       CDS       T00909                                 

Definition
(GenBank) hypothetical protein
Organism
ere  Eubacterium rectale ATCC 33656
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 2-Hacid_dh_C AlaDh_PNT_C ThiF TrkA_N 3HCDH_N Shikimate_DH F420_oxidored NADH_4Fe-4S NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ACR75170
UniProt: C4Z8T9
LinkDB All DBs
Position
1291681..1292709
Genome map
AA seq 342 aa AA seqDB search
MLQQVMTNPGEIIFREVPVPEVKENQVLVKIMNIGVCGSDIHVYHGKHPFTKYPVTQGHE
VSGEITELGKNVTEFHVGQKVTIEPQVYCGHCYPCRHGKYNLCEELKVMGFQTTGTASEY
FAVDASKVTPIPKEMSYEEGAMIEPLAVAVHGVKQMGDVAGMNIAVLGAGPIGNLVAQTA
IGMGAAKVMITDISDLRLAKAKECGIDVCVNTKNKDFGEAMIEAFGPDKADVIYDCAGNN
ITMGQAIKYARKGSTIVLVAVFAGMAEVDLAVANDHELDIKSTMMYRHDDYIDGIRLVNE
GKVHLKPLISKTFAFKDYLKAYQYIDDNRETTMKVIINVSEK
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgttacagcaggtaatgacaaatccaggagaaattattttcagagaggttccggttccg
gaggtaaaggaaaaccaggttttggtaaagattatgaatattggtgtttgtggatcagat
attcatgtttatcatggaaaacatccgtttacaaaatatccggtaacacaaggacatgag
gtttcaggtgagattacagaacttggaaaaaacgtcacagagtttcatgtgggacaaaag
gtgacgatagagcctcaggtatattgtggacattgctatccatgtcgtcatggaaagtat
aatctctgtgaggaattaaaagtaatgggatttcagacaacaggaacagcatctgagtat
tttgcagtggatgcatctaaagtaacacctattccaaaagaaatgtcctatgaagaagga
gctatgatcgaacctcttgctgtggcagttcatggtgtaaaacagatgggcgatgtggct
ggcatgaatattgcagtccttggagcaggaccgattggaaatctcgtggcacaaacagca
attggaatgggtgcagcgaaagtaatgatcacagatattagtgatcttagactggcaaag
gcaaaagaatgtggaattgatgtgtgtgtgaataccaaaaataaagacttcggtgaggca
atgatcgaagcatttggaccggataaggcagatgtgatctacgactgtgccggaaacaat
atcacaatgggacaggcaattaaatatgcaagaaaaggaagcacgattgtattggtggct
gtttttgcaggaatggcagaagtagatcttgcagtggcaaatgatcacgaacttgacatt
aagagcacgatgatgtaccgccatgatgattacatagatggaatcagactggtaaatgag
ggaaaagttcatttgaaaccgctcatctcaaagacatttgcttttaaagattatctgaag
gcataccagtatattgatgataaccgcgagacaacgatgaaagtgattatcaacgtcagt
gaaaagtaa

DBGET integrated database retrieval system