KEGG   Erythrobacter sp. THAF29: FIU90_08125Help
Entry
FIU90_08125       CDS       T06318                                 

Gene name
qbdA2
Definition
(GenBank) Quinohemoprotein alcohol dehydrogenase ADH IIB precursor
  KO
K17760  quinohemoprotein ethanol dehydrogenase [EC:1.1.9.1]
Organism
erf  Erythrobacter sp. THAF29
Brite
KEGG Orthology (KO) [BR:erf00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    FIU90_08125 (qbdA2)
Enzymes [BR:erf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.9  With a copper protein as acceptor
    1.1.9.1  alcohol dehydrogenase (azurin)
     FIU90_08125 (qbdA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PQQ_2 PQQ PQQ_3 Cytochrome_CBB3 Cytochrom_C LPAM_2
Motif
Other DBs
NCBI-ProteinID: QFT77501
LinkDB All DBs
Position
1659530..1661659
Genome map
AA seq 709 aa AA seqDB search
MADISQILRRAAPAILLASLATLSGCGSTSDGAVSEQLLLEAGEDAANWLSHGRTYNEER
FSPLEQINADNVGELGLAWEAPLGSFRGIEATPIVVDGVMYTTGSWSEVIALNAATGEVL
WKYDPEVPREKGRHACCDVVNRGVAVYQDKLFFGTIDGRLIALDQKSGDQVWETRTFPIE
EPHTITGAPRVVKGRVIIGNGGAEFGVRGFVAAYDAETGEQEWKFHTVPGNPKDGFENEA
MEMAAETWKGEWWELGGGGTVWDSMAYDPELDLLYIGVGNGAPWNQKVRSPGGGDNLFLS
SIVALRPDSGEYVWHYQTTPGETWDFTATQSIILADLEIGGEARKVLMQAPKNGFFYVID
RTDGKLISAENFVPVTWAKGIDPETGRPIENPEARYPEGMALVKPTPFGAHNWHPMSYSP
QSGLVYIPAQDMPFLYRDQIEGDIARVDRDGLNTGVSLTDPLPDTEAERRALMKQMIRAQ
LVAWDPVAQKEVWRVEHERIWNGGTLATGGNLVFQGTTKGIFNAFNAKTGDTLWSFTVGA
AMVGGPVSYEVDGEQYIAVSVGWGSGANLLAGYYVDPKGGKVEGRVIAFKLGADGKISLR
QPAKSELPRPARRPSSTEAVARGTDLYGRFCGICHGGAAISAGTTPDLRYSATLGNDAFH
AFVLEGAAAANGMPNFNGRLSKEEVSDIEDFLLSRAWLAFEDTSTTETD
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atggctgatatttcgcaaatcctgagaagggccgcgcccgccattctgctcgcaagcctt
gcaacattatcaggatgcggaagtaccagtgacggtgcggtgagcgaacaactcttgctt
gaagcgggggaagatgcagccaactggctctcgcacgggcgcacctataatgaagaacgc
ttcagtccgctcgaacagatcaatgcggacaatgtcggcgagctcggtctggcttgggaa
gcgccgctgggcagtttccgcggcattgaagctacacccattgtggttgatggcgtgatg
tacactaccggttcgtggagcgaagtgatcgcgctcaatgcggcaaccggcgaggtgttg
tggaaatacgacccggaagtcccgcgtgaaaaagggcgccatgcctgctgcgatgtcgtc
aatcgcggggtcgcggtctatcaggacaagctgttttttggcacgattgacggacggctg
attgcgcttgaccagaaaagcggcgatcaggtctgggaaacccgcacattcccgattgaa
gaacctcacaccatcaccggcgcaccgcgtgtggtgaaaggccgtgtaattatcggcaat
ggcggggctgaatttggcgtacgcggctttgtcgcagcctatgatgccgaaacgggtgag
caggaatggaaattccacaccgtacccggcaatcccaaagatgggttcgaaaacgaagcc
atggaaatggccgctgaaacatggaagggcgaatggtgggaattgggcggtggcggcacc
gtatgggattccatggcctatgatcccgagcttgatctgctttatatcggtgttggcaat
ggtgcgccgtggaaccagaaagttcgcagccccggcggcggtgacaatctgttcctttcc
tccatcgtcgcgctgcgccccgatagcggggaatatgtctggcactatcagacaacaccg
ggcgaaacctgggactttacggccacgcagagcatcattctggccgatctggagattggc
ggggaagcccgcaaggttttgatgcaggctccgaaaaacggctttttctatgtgattgac
cggaccgacgggaagctgatttcggccgagaatttcgtgccggtaacatgggccaagggc
attgaccctgaaaccggacgtccgattgagaatccggaagcgcgctatccggaaggaatg
gcgctggtcaaacccactccgttcggcgcgcataattggcacccgatgtcctacagcccg
cagtccgggctggtatacattccggcgcaggatatgccgtttctttatcgcgatcagatc
gaaggcgacattgcgcgggtggatcgcgatggtctcaacaccggcgtcagcctgacggat
ccgcttcccgacacagaggccgaacgacgcgcgctgatgaagcagatgatccgcgcccag
ctggttgcgtgggatccggtcgcacagaaagaagtctggcgggttgagcacgaacggatc
tggaacggcggtacgctggccacaggcggtaatctggtatttcagggaaccaccaagggg
attttcaacgccttcaacgccaaaactggcgacacgttgtggtccttcactgtcggtgca
gctatggttggcggccctgtttcctacgaggtggatggtgaacaatatatcgctgtctcg
gtcggttggggcagcggcgcgaacctgctggccggatattatgtcgatcccaaaggcggc
aaggtcgaagggcgcgtgatcgcgttcaagctcggcgccgatggcaaaatctcattacgg
caacccgccaagagcgagctgccacgtccggcacgacgccccagctccactgaagccgtc
gcacgcggaaccgatctctacgggcgtttctgcggcatctgccatgggggcgcagctatc
tcggctggcaccacgcccgatctgcggtactcggcaacattgggtaacgatgcgttccac
gccttcgtccttgaaggtgcagcggcagccaatggcatgcccaatttcaacggtcggctg
agcaaagaggaagtcagcgacatcgaggactttctcctgtcacgcgcatggctcgctttt
gaagataccagcactacagaaactgactga

DBGET integrated database retrieval system