KEGG   Erythrobacter sp. THAF29: FIU90_15500Help
Entry
FIU90_15500       CDS       T06318                                 

Gene name
ahpF
Definition
(GenBank) Alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
erf  Erythrobacter sp. THAF29
Brite
KEGG Orthology (KO) [BR:erf00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    FIU90_15500 (ahpF)
Enzymes [BR:erf01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     FIU90_15500 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 FAD_oxidored HI0933_like K_oxygenase NAD_binding_8 DAO AlaDh_PNT_C FAD_binding_3 Thi4 FMO-like Trp_halogenase
Motif
Other DBs
NCBI-ProteinID: QFT78953
UniProt: A0A5P9GZ11
LinkDB All DBs
Position
3183894..3185483
Genome map
AA seq 529 aa AA seqDB search
MLDANMQTQLKQYLANLREPIELVASLDDSEKSAQTRELLTEIAALHDMVSAQFDGTHER
RPSFIIRRASDADKWVRFAGLPMGHEFTSLVLALLWAGGHPPKIDADLIEQVRALEGDYD
FEMFFSLSCHNCPDVVQALTLMALENPRITATLIEGGTFQDEVEARGVLAVPATFLNGES
FYNGKMELAEILSKLDSGADAKAAEKMSAKEPFEVLVIGGGPAGAAAAVYTARKGFRTGI
AADRFGGQLQDTLGIENLPGTSYTEGPKLSEDLKKQVRDNEIDLMDLARATQLKPASEAG
GMHEIVMANGATIKARALILATGARWKNLGVPGEAEYRNKGVAYCPHCDGPLFKGKRIAV
VGGGNSGVEAAIDLAKIVGHVTLIEFDAKLRADEVLQRKLRSLPNVEIITNGQTTEITGD
GSRVNGLVFKDRTSGDEHRIELEGVFVQIGLVPNTEWLEGSGLELSQYGEIVIDEEGATN
LPGIYAAGDATTVPHKQIVVAMGEGSKAALGAFDYLIRNEPVDEIAAAA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgctcgatgcgaacatgcagacccagcttaagcaatatctcgccaacctgcgcgagccg
atcgaactcgttgcgtcgctcgatgacagcgagaagagcgcgcagacgcgtgagctgctg
acggagatcgccgcgcttcacgatatggtgagcgcgcagttcgacggcacgcacgagcgc
aggcccagcttcatcatccggcgcgcttcggatgcagacaaatgggtgcgtttcgcaggt
ttgccgatgggccatgagtttacgagcctggtgcttgcgcttctctgggcaggcgggcat
ccccccaagatcgacgccgacctcatcgaacaagtccgcgcattggaaggcgattacgat
ttcgagatgttcttctcgctctcgtgccacaattgccccgacgtggtgcaggctctgacg
ctgatggcgctcgaaaacccgcgcatcaccgcgacgctgatcgaaggcggcacgttccag
gacgaagtcgaggcacgcggcgtgctcgcggtccctgcaaccttcctcaacggcgaaagc
ttctacaacggtaagatggaattggccgagatcttgtcgaagctcgacagcggcgccgat
gccaaggcggcagagaagatgtcggccaaagaacctttcgaagtgctcgtcatcggcggc
ggccccgcgggcgcagcagccgcggtctatactgcgcgcaagggcttcaggaccggcatc
gcagccgatcgtttcggcgggcagcttcaggacacgctcggcatcgagaaccttcccggc
acgagctacaccgaaggcccgaaactctcggaagacctcaagaaacaggttcgcgacaac
gagatcgacctcatggacctcgcccgcgcaacccagctcaagcctgcgagcgaagcgggc
ggcatgcatgagatcgtgatggcgaacggtgcgacgatcaaagcgcgcgctctcattctc
gcgaccggcgcgcgctggaagaaccttggcgtcccgggtgaagccgaatatcggaacaaa
ggcgtagcctattgtccgcattgcgacggaccgctgttcaagggcaagcggatcgcggtt
gtcggcggcggcaactcgggcgtcgaagccgcgatcgaccttgcaaagatcgtcggccac
gtgacgctgatagagtttgacgccaagctgcgcgctgacgaagttctgcaacgcaaattg
cgttcgctccccaatgtcgagattatcacgaacggtcagacgaccgagatcactggtgat
ggctcgcgtgtcaacgggctcgttttcaaggatcggaccagcggagacgaacaccgcatc
gagcttgaaggagtttttgtccagatcggactcgtgcccaacaccgaatggctcgaaggc
agcggactcgaactgtcgcaatacggcgagatcgtgatcgacgaggaaggggcaaccaac
cttcccggtatctacgccgctggcgatgccacaaccgttccgcacaagcagatcgtggtc
gcgatgggcgaaggttcgaaagccgcactcggcgcattcgattacctgatccgtaacgag
ccggtggacgagatcgcagcagccgcctga

DBGET integrated database retrieval system