KEGG   Erysipelothrix rhusiopathiae Fujisawa: ERH_0835
Entry
ERH_0835          CDS       T01525                                 

Definition
(GenBank) hypothetical protein
Organism
erh  Erysipelothrix rhusiopathiae Fujisawa
SSDB
Motif
Pfam: UPF0242 HrpB7 DUF1664
Other DBs
NCBI-ProteinID: BAK31890
LinkDB
Position
882645..884480
AA seq 611 aa
MNDFFDMSFGDDSKSNDFAMPTFDASNDIDDDEDDDLEESSNKFKKTLFGGYTRGSVEAY
VEQIEQNVSQMQGNLEFQIKEMLLEKASLSQENALLKSQFTDAESKMIEIEEEYKRIKGL
NEELAENIKNQELQFSTELNQYKTVSGELQEELDKISSHYQSLQEQLERAHGEVSVLTQQ
VKENEEENIKVEQYLDQLESSLQEKNRALEESVRLLKEKEIELETSNAEVHELREQMLVM
ETKLAEKDSEIARTMKILEEYQAQEENFMALIDQKEDMIIERNNALQEAARMVESLESQR
EAFESRLMDQQGTIDEQQESIEHTQYVLDEKEEEIKTLELKIQQLTDAVEAMNSQDDLAV
ETLTNEVEFLTKKLDLMTSEKDETVMLLQEKIQNLTQQLEQVQLQPNIMQRVEDIRTQYD
QLLQKKDIIINRLEAEVNSAPSFTFDQERALLKQEIAQLQEELKQEMIDKYQVRKGLNDE
VRRLKERLDTQTFQGQPRQDFERIIDEKDTQINQLFQKLQNMQKEMEALMGRVNFTNPSH
DALQERTRIQHMNIQEPALEPVSNFVPTPQVVEPVVAAKNDFEEEIARIYKQIEAQRETL
DAFMDHYKYNS
NT seq 1836 nt   +upstreamnt  +downstreamnt
atgaacgatttttttgatatgagttttggtgatgattcaaaatcaaacgactttgccatg
ccgacatttgacgcatcaaatgacatcgacgatgatgaagatgatgatctcgaagaatca
tcgaataaattcaaaaagacacttttcggaggctatacacgtggtagtgttgaagcatat
gtagaacaaattgaacaaaatgtttcacaaatgcaaggaaacctcgaatttcaaatcaaa
gaaatgttgcttgaaaaagcttcactttctcaagaaaatgcattactcaagtcacaattt
acagatgcagaatctaaaatgattgaaattgaagaagagtacaaacgcattaaaggttta
aatgaagaattagctgaaaatattaagaatcaagaactacagttttcaactgagttaaat
caatacaaaaccgttagtggagaattacaagaagaattagacaaaatatcttctcactat
caatcactccaggaacagttagaacgtgctcatggtgaagtttccgttttaacacagcaa
gtgaaagaaaatgaagaagaaaatattaaagttgagcaataccttgatcaacttgaatct
agcctacaagaaaagaatcgtgcactcgaagaaagtgtacgcctcttaaaagaaaaagaa
attgaacttgaaacaagtaatgcggaagttcatgaattacgcgaacaaatgcttgttatg
gaaactaaactagcagaaaaagattcagaaatcgcacgtactatgaaaattttagaagaa
tatcaagctcaagaagaaaactttatggctttaattgatcaaaaagaagatatgattatt
gaacgcaataatgcacttcaagaagcagcgcgcatggttgaatcattagaaagccaacgc
gaagcatttgaatcacgtctaatggatcaacaaggaacaattgatgaacaacaagagtca
attgaacatacgcagtatgtacttgatgaaaaagaagaagagattaagacacttgaatta
aaaattcaacaacttacagatgctgttgaagcaatgaacagccaagatgatttagctgtt
gaaacattaaccaatgaagttgagtttttaactaagaaacttgaccttatgacatctgaa
aaagatgagacagtaatgttgttgcaagaaaagattcaaaatcttacacaacaacttgaa
caagttcaattacaaccgaatattatgcaacgtgtagaagatatccgtacgcaatatgat
caattacttcaaaagaaggatattatcattaaccgtttggaagcagaagttaacagcgcg
ccatcttttacattcgatcaagaacgtgcacttctaaaacaagaaattgcgcaattgcaa
gaagaactcaagcaagaaatgattgacaaatatcaggttcgtaaaggattgaacgatgag
gtgcgtcgtctcaaagaacgattagatacacaaacgtttcaagggcaacccagacaagac
tttgaacgcattatcgatgaaaaagacacccaaatcaatcaactctttcagaaattacag
aatatgcaaaaagaaatggaagcattaatgggacgtgttaattttacaaacccatctcat
gatgcacttcaagaacgtactcgtattcaacatatgaatatacaagagcctgcccttgag
ccagtttcaaattttgtaccaacaccacaggttgttgaacctgtagttgcagctaaaaat
gactttgaagaggaaattgctcgtatctacaagcaaattgaagctcaaagagaaacttta
gatgcatttatggatcattataaatacaattcataa

DBGET integrated database retrieval system