KEGG   Erwinia sp. Ejp617: EJP617_18440Help
Entry
EJP617_18440      CDS       T01935                                 

Definition
(GenBank) Peptidoglycan synthetase
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
erj  Erwinia sp. Ejp617
Pathway
erj00550  Peptidoglycan biosynthesis
erj01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:erj00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EJP617_18440
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    EJP617_18440
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:erj01011]
    EJP617_18440
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:erj03036]
    EJP617_18440
Enzymes [BR:erj01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     EJP617_18440
Peptidoglycan biosynthesis and degradation proteins [BR:erj01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   EJP617_18440
Chromosome and associated proteins [BR:erj03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    EJP617_18440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: ADP11525
UniProt: E3DGY1
LinkDB All DBs
Position
2033364..2035079
Genome map
AA seq 571 aa AA seqDB search
MPPLRQSLAKSQTAPTFNPLRFRLVCLGVFSCLVFLLLRVADLQLINHPMLEKEADQRSL
RTVTLPTSRGTLLDRNGEALALSVPSRDIIADPQRVLGAHPDFTSAKWQYLANALEQRPE
QIAAQIGANPNRRFLYLGHKIELGIAKDIGKLHLAGISTVYNDSRFYPMSEATAPLIGIV
GAENSGLSGLEKGFDKLLRGTPGVEKYRQDASGNIVAMINYEPPQQPPTVQLSIDKFDQY
TLYSKLRDGVLLNKADSGAAVLIKIDTGEILGMASYPSFNPNHFVDVSPAQMRNAAINDS
YEPGSTVKPLVVMEGLARKLVRPDSVLDTIPYRVNGHLIRDVGHWSRLTMTGILQKSSDI
GVSHIALAMPAEVLVNTYQAFGLGKSTGLGLTGESVGYFPLHRQRWADIERATFSFGYGL
RVTPLQIAREYATLGSFGVYRPLSITKVTPPVLGKRVADEQTVRAVVRMMESDALPGGSG
VRAAVPGYRLAIKTGTAEKMGDSGKYDGGYINYTAGVAPASHPQVALVIMINHPTAGDHF
GGSVAAPVFGNIIGPVLKHMNIPPDALYNHS
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgttaagacaatctctggctaaatcccagactgctcctacctttaatcccttg
cgtttccggcttgtttgccttggcgtgttttcctgtctggtttttttactgctgcgggtg
gcggatttacagctgattaatcatccgatgctggaaaaagaggccgaccagcgttcgttg
cgcaccgtgacgctaccgaccagtcgcggtacgttgttggatcgcaatggcgaagcgctg
gcgctcagcgtgccgtcgcgcgatattatcgccgatccgcagcgcgtgctgggggcgcat
ccggattttaccagcgcgaaatggcagtaccttgccaatgcgctggagcagcgcccggaa
cagattgccgcacagatcggtgctaaccccaaccgccgcttcctttatcttggccataaa
atcgaactgggcattgcgaaagatattggcaaactgcacctcgcgggcattagcacggtg
tataacgacagccgtttctacccgatgagcgaagccaccgcgccgctgatcggtattgtg
ggtgcggagaacagcggccttagcgggctggaaaagggctttgataagctgttgcgcggt
acgccgggcgtggagaaataccgccaggatgccagcggcaatattgtggcgatgatcaac
tatgagccaccgcagcaaccgccaacggtgcagctcagtattgataaatttgaccagtac
accctgtacagcaaattgcgcgacggggtgcttcttaacaaagcggattccggcgcggcg
gtgctgataaagatcgataccggggagatcctcggcatggcctcttatccgtcattcaac
ccgaaccatttcgttgatgtttcaccggcgcagatgcgcaatgcggcaattaacgacagc
tatgagccgggttcaacggtcaagccgctggtggtgatggaaggcctggcgcgcaagctg
gtgcgcccggattccgtactggataccataccgtaccgggttaacggccatctgatccgc
gatgtaggccactggtcgcgattgaccatgaccggcatcctgcaaaaatccagtgatatc
ggcgtatcgcatattgcgctggcgatgccggccgaagtgctggtgaacacctatcaggcg
ttcggattaggcaagtcgaccggactgggcctgaccggagagagcgtcggctacttcccg
ctgcaccgccagcgctgggccgatattgaacgcgccaccttctcttttggctatggactg
cgcgtgacccctctacagattgcacgcgaatatgccaccctcggctcgtttggcgtttat
cgcccgttatcgataactaaagtcacgccgccggtgctgggtaaacgcgtggccgatgag
cagacggtacgggcggtggtgcgtatgatggagagtgatgcgctgccgggcggtagcggc
gtacgcgccgccgttccgggctaccgtctggcaattaaaaccggcactgccgaaaagatg
ggcgacagcggcaaatatgacggcggctatatcaactacaccgccggggtagcaccggcc
agtcatccccaggtggcgctggtgattatgattaaccatccaacggcgggcgatcacttc
ggcggctcggtagcggcaccggtgtttggcaatattattggcccggtgctgaagcatatg
aatattccccccgacgcgctctacaaccacagttga

DBGET integrated database retrieval system