KEGG   Erythrobacter sp. KY5: CD351_05690Help
Entry
CD351_05690       CDS       T05511                                 

Definition
(GenBank) Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
erk  Erythrobacter sp. KY5
Pathway
erk00970  Aminoacyl-tRNA biosynthesis
erk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:erk00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CD351_05690
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:erk03029]
    CD351_05690
Enzymes [BR:erk01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     CD351_05690
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     CD351_05690
Mitochondrial biogenesis [BR:erk03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CD351_05690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AWW73915
UniProt: A0A2Z4JYQ3
LinkDB All DBs
Position
1188562..1190058
Genome map
AA seq 498 aa AA seqDB search
MSDYRIQGATGEWEVVIGLEVHAQVTSKSKLFSGANTEFGAEPNSQVSLVDAAMPGMLPV
PNRECIRQAVRTGMAIEAEINQWSRFDRKNYFYADLPQGYQISQLYHPLVGEGQLLIEAD
EKTGIPEDKIIGIERIHVEQDAGKLMHDQHPTMSYVDLNRSGVALMEIVSRPDMRSPAEA
GAYVRKLRSILRYVGSCDGNMEEGSMRADVNVSVRKVGEELGTRTETKNVNSVRFVMQVI
EYEANRQVDVLESGGTVDQETRLFDVATGTTRTMRSKEDAHDYRYFPDPDLLPLVLEDDF
LEECRASLPELPDAKRTRYESELGLTPYNARELTAEVETFARFETLLSATASATGKDEKT
VATQVANWALSVAPGVIKSLGDEANVEHATAERQAAILAMQDKGEISGGQAKEIFEIVLT
QGREPAEIAQTEGLKQVSDTGAIEAAIDDILANNEDKVEQYRGGKDKLFGFFVGQTMKAM
QGKANPAVVNQILKDKLG
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgagtgactatcgcatccagggcgcaacgggcgagtgggaggtcgtgattggccttgag
gtccatgcgcaggtgacttccaagtcgaaactgttttcgggtgccaacaccgaattcggc
gcggagccgaacagccaggtgagcctcgtcgatgcggccatgcccggaatgctgcccgtg
cccaaccgcgagtgcatccgtcaggcggtgcgcaccggcatggcgattgaggccgaaatc
aaccagtggtcacgctttgaccgcaagaactacttctacgccgatctgccgcagggctat
cagatcagccagctttaccacccgctcgtgggtgaggggcagttgctgatcgaagcggac
gaaaagaccggcattcccgaagacaagatcatcgggatcgaacgcatccacgttgaacag
gacgcgggcaagctgatgcacgatcagcacccgaccatgtcctatgtcgatctgaatcgt
tcgggggttgcgctgatggaaatcgtctcgcgccctgacatgcgctcgcctgccgaagcc
ggggcctatgtgcgcaagctgcgctccatcctgcgctatgtcggatcgtgcgatggcaac
atggaagaaggctctatgcgcgccgacgtgaacgtttccgtccgcaaagtcggcgaggaa
ctgggcacgcggaccgagacgaagaacgtgaactcggtgcgcttcgtcatgcaggtcatc
gaatatgaggcgaaccgtcaggtcgatgtgctggaaagcggcggcacggttgaccaggaa
acgcgcctattcgacgtcgcgaccggcacgacgcgcacgatgcgttccaaggaagacgcg
catgattatcgctacttccccgatcccgacctgctgccgctggtgctggaagacgacttc
ctcgaagaatgtcgcgcttccctccctgaactgcccgatgccaagcgcacgcggtatgag
agcgagcttggcctcacgccttacaacgcgcgcgagctgactgccgaggtcgaaaccttt
gcgcgcttcgaaacgctgctttcggccacggccagcgccacgggcaaggacgaaaaaacg
gttgcgacgcaggttgcgaactgggcgctttcggtcgcgccgggcgttatcaaatcgctc
ggcgacgaagccaatgtcgaacacgccaccgccgagcgtcaggccgctatcctcgcaatg
caggacaagggcgagatcagcggcggtcaggccaaggaaattttcgagatcgtgctcaca
cagggccgcgaacccgccgaaatcgcccagaccgagggcctcaagcaggtcagcgatacc
ggcgcgatcgaggccgccattgacgatatcctcgccaataacgaggacaaggtcgaacaa
tatcgcggcggcaaagacaagctcttcggcttcttcgtcggccagacgatgaaagcgatg
cagggcaaggcgaacccggcggtggtcaaccagattctcaaggacaagctgggctag

DBGET integrated database retrieval system