KEGG   Erythrobacter sp. KY5: CD351_06140Help
Entry
CD351_06140       CDS       T05511                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
erk  Erythrobacter sp. KY5
Pathway
erk00473  D-Alanine metabolism
erk00550  Peptidoglycan biosynthesis
erk01100  Metabolic pathways
erk01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:erk00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CD351_06140
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CD351_06140
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    CD351_06140
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:erk01011]
    CD351_06140
Enzymes [BR:erk01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CD351_06140
Peptidoglycan biosynthesis and degradation proteins [BR:erk01011]
 Precursor biosynthesis
  Amino acid ligase
   CD351_06140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AWW74005
UniProt: A0A2Z4JYZ1
LinkDB All DBs
Position
1292933..1293904
Genome map
AA seq 323 aa AA seqDB search
MSDAAPLHVAVLMGGWANEREVSLMSGAGVSDALEMNGHRVTQIDMGRDVAQRIAEIKPD
VVFNALHGVPGEDGSVQGMLDLMGLPYTHSGMATSVIAIDKQLTKQALIPHGVPFPGGRI
VATKDIFERDPLPRPYVLKPVNEGSSVGVAIVTEDSNVGNPINRDALGPWQQFDRLLAEP
FIKGRELTTAVIDSADGPRALGVTELVIEHGFYDYEHKYTEGRTQHVCPADIPAEIAALC
EDYAIRAHTVLGCHGTSRTDFRWDDEAGEDGLFVLETNTQPGMTPLSLVPEQAKHAGISY
PELVKLIVREALRVHAAKGGADG
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgacgccgcgcccctccatgtcgcggtcctgatgggcggctgggcgaatgagcgt
gaggtttctctgatgtccggcgcaggtgtgtccgatgcgcttgaaatgaacggccaccgc
gtcactcagatcgacatgggccgcgacgttgcgcagcgtatcgccgagataaagcctgac
gtcgtgttcaacgcgcttcacggagtgccgggcgaagatggcagcgttcagggcatgctc
gacctcatgggcctgccctacacccattcgggaatggcgacctcggttattgccatcgac
aagcagctgaccaagcaggcgctgatcccgcatggcgttccttttccgggcggacggata
gtggcgacgaaggacattttcgagcgcgatccgcttccgcgcccttacgttctcaaaccc
gttaatgaagggtctagcgtcggcgtcgccattgttacggaagactccaacgtgggcaac
ccgatcaatcgcgacgcgctcggaccgtggcagcaattcgaccggcttctcgccgagccc
ttcatcaaggggcgtgagcttaccactgccgtgatcgacagcgctgatgggccgcgcgcg
cttggcgtgaccgaactcgttatcgagcacggcttttacgactacgagcacaaatacacc
gaaggacgcacccagcatgtgtgccccgccgacatccccgccgaaatcgctgccttgtgc
gaggactacgcgatccgtgcgcacacggtgctcggctgccacggcaccagccgcacggat
ttccgctgggacgacgaggcaggcgaggatggccttttcgtcctcgaaaccaacacgcag
ccgggcatgacgccgctcagcctcgtccccgagcaggccaagcatgccggtatcagctac
cccgaactcgtcaaactgattgttcgcgaggccctcagggttcacgccgcgaaaggaggc
gcagatggctaa

DBGET integrated database retrieval system