KEGG   Erythrobacter sp. KY5: CD351_08230Help
Entry
CD351_08230       CDS       T05511                                 

Definition
(GenBank) alpha/beta hydrolase
  KO
K15756  2-hydroxy-6-oxo-6-(2'-aminophenyl)hexa-2,4-dienoate hydrolase [EC:3.7.1.13]
Organism
erk  Erythrobacter sp. KY5
Pathway
erk00621  Dioxin degradation
erk01100  Metabolic pathways
erk01120  Microbial metabolism in diverse environments
erk01220  Degradation of aromatic compounds
Module
erk_M00544  Carbazole degradation, carbazole => 2-oxopent-4-enoate + anthranilate
Brite
KEGG Orthology (KO) [BR:erk00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    CD351_08230
Enzymes [BR:erk01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.13  2-hydroxy-6-oxo-6-(2-aminophenyl)hexa-2,4-dienoate hydrolase
     CD351_08230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Abhydrolase_2 Esterase Abhydrolase_4 FSH1 DUF2048
Motif
Other DBs
NCBI-ProteinID: AWW74411
UniProt: A0A2Z4K0W1
LinkDB All DBs
Position
1743783..1744649
Genome map
AA seq 288 aa AA seqDB search
MSIQPEASVPASQVAESRYFVADGIETHYLEAGDPNAQTVILVHGGGAGANAMGNWAACI
PLFTENFHVIAPEMVGFGDTEKPGGEFEYSQGARNRHMAAFIEGMGLGPACIVGNSMGGA
TALGVAMERPELIDRLVLMGSAGLNAQITPSMAPILNYDFTFEGMRRLVAALTGPKYEAT
EEILASRYESSIRPDARAAYGKTMAWIGEQGGLFYEEDAIAAVKHQTLVVSGKDDLVVPF
DRGVRFLELLENSRGYFMPHIGHWVMIEAPEEFVDVVTSFLQIDEEQL
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatccagcctgaagcgtcggtgcccgcatcgcaggtggcagaatcgcgttatttc
gtcgccgacgggatcgagacacattatcttgaagcgggcgatccaaatgctcagaccgtc
atcctcgtccacgggggtggggccggagcaaacgcaatgggtaactgggcagcttgcatt
cccctgttcactgagaacttccacgtcattgcgccggaaatggtcggctttggtgacacc
gaaaagcccggcggcgaattcgaatacagccaaggcgcgcgcaatcgacacatggctgcc
tttatcgaaggcatgggccttggtcctgcctgcatcgtcggcaattcgatgggcggggca
accgctctcggggtggcaatggagcgtcccgagctgatagaccggctggtcttgatggga
agcgctgggctgaacgcgcagatcactccttcaatggcgccaatcctgaattatgacttc
acgtttgaggggatgcgccgtcttgtcgccgctctaaccggtccgaaatacgaggcgacc
gaggaaatcctcgcatcgcgctatgagagttccattcggcccgatgccagggcggcctac
ggaaaaaccatggcgtggatcggggagcagggcggcctgttctacgaggaagacgcgatc
gccgccgtcaagcatcagacgcttgtcgtaagcggaaaggacgatctggtcgtgccgttc
gacaggggcgtgcggttcctcgaattgctggaaaactcacgcggttatttcatgccgcat
atcggccactgggtgatgatcgaagcccccgaggaattcgtcgatgtggtgacctctttc
ctgcagatcgacgaggagcagctatga

DBGET integrated database retrieval system