KEGG   Erythrobacter sp. KY5: CD351_10085Help
Entry
CD351_10085       CDS       T05511                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
erk  Erythrobacter sp. KY5
Pathway
erk00010  Glycolysis / Gluconeogenesis
erk00020  Citrate cycle (TCA cycle)
erk00620  Pyruvate metabolism
erk01100  Metabolic pathways
erk01110  Biosynthesis of secondary metabolites
erk01120  Microbial metabolism in diverse environments
erk01130  Biosynthesis of antibiotics
erk01200  Carbon metabolism
Module
erk_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:erk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CD351_10085
   00020 Citrate cycle (TCA cycle)
    CD351_10085
   00620 Pyruvate metabolism
    CD351_10085
Enzymes [BR:erk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CD351_10085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 DEC-1_N TALPID3
Motif
Other DBs
NCBI-ProteinID: AWW74772
UniProt: A0A2Z4K1A1
LinkDB All DBs
Position
2131779..2133191
Genome map
AA seq 470 aa AA seqDB search
MAIELKMPALSPTMEEGTLARWLVKVGDEIASGDIMAEIETDKATMEFEAVDEGTLAAIL
VEEGTENVSVGTVIAMLAEEGEDVSDVSAPSADATPAPTPAPTPEPAATPAPAPANSNHA
NDDVKASPLARRIAVNEGVDLSSLEGSGPKGRIVKSDVEAAIGGGSPQTVARSRNRVIAS
PLARKLAADAGYTLGEISGSGPGGRIIKADVDAFTPAPAAPKKDEAAPAPAAAKQPANDL
DAPYEELKLNNVRKVIARRLTEAKQTVPHIYLTVDIRLDALLKLRSELNAALEADGVKLS
VNDLIIKALAKALTREPQCNVSFQGDVMHQYSRADISVAVAAPSGLITPIIRDAGRKSLA
DISAEMKELAGKARDGKLQPHEYQGGTASLSNLGMFGTKQFDAVINPPQGMILAVGAGEK
RPYVVDDELTVATVMSATGSFDHRAIDGVDGAKLMDQLRTLIENPMGLVV
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggcaatcgaactaaaaatgcccgccctttcgcccacgatggaggaggggacgcttgcc
cgctggctggtcaaggtcggcgacgaaatcgcatcgggcgacatcatggccgagatcgag
accgacaaggcgacgatggaatttgaagctgtggacgaaggaacgcttgccgcgatcctc
gtcgaggaaggcaccgagaatgtttccgtcggcaccgttatcgcgatgctggccgaagag
ggcgaggatgtcagcgatgtgagcgcaccttcggccgatgccacccctgcgccaactccc
gcgcccactcccgaacccgctgcgacccccgctcccgcgcctgccaactccaaccacgcc
aatgacgacgtgaaggccagcccgctagcgcgccggatcgcggtcaatgaaggcgttgac
ctgtcgagcctcgaaggcagcggtcccaagggccggatcgtgaaatcggacgtcgaagcg
gccatcggaggcggaagcccccagaccgtcgcgcgttcaaggaaccgcgtgatcgcatcg
ccacttgcgcgcaagctggcggcggatgcgggatacacgctgggcgaaatctccggttca
ggtccgggtggccggatcatcaaggccgatgtggacgccttcacccccgcacccgccgcg
cccaagaaggacgaggccgcgcctgcaccagcagccgcaaagcagcccgccaacgatctc
gatgcgccttacgaggagctcaagctcaacaatgtgcgcaaagtcatcgcgcgccgcctg
accgaagcgaagcagaccgtgccgcatatctacctcacggtcgatatccggctcgatgcg
ctgctcaagctgcgcagcgaattgaacgccgcgctcgaagcggacggggtgaagctttcg
gtcaacgacctgattatcaaggcactggccaaggcgctcacccgcgagccgcagtgcaat
gtgagctttcaaggcgatgtgatgcaccaatattcgcgcgccgatatctcggtcgcggtg
gcggcgcccagcggcctcatcaccccgatcatccgcgatgcgggccgcaagagccttgcc
gacatctccgccgagatgaaggagcttgcgggtaaggcgcgcgacggcaagctgcaaccg
cacgaatatcagggcggcacggccagcctgtccaacctcggcatgttcggaaccaaacaa
ttcgacgcggtcatcaacccgccgcagggcatgatcctcgccgtgggcgcaggcgaaaag
cggccctatgtggtcgatgacgaactgactgtagccacggtgatgagcgccaccggcagc
ttcgatcaccgcgcgattgatggcgtggacggggcgaaactgatggatcaactgcggacg
ctgatcgagaacccgatggggctggtggtgtga

DBGET integrated database retrieval system