KEGG   Erythrobacter sp. KY5: CD351_10610Help
Entry
CD351_10610       CDS       T05511                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
erk  Erythrobacter sp. KY5
Pathway
erk00061  Fatty acid biosynthesis
erk00780  Biotin metabolism
erk01100  Metabolic pathways
erk01130  Biosynthesis of antibiotics
erk01212  Fatty acid metabolism
Module
erk_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:erk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CD351_10610
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CD351_10610
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    CD351_10610
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:erk01004]
    CD351_10610
Enzymes [BR:erk01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     CD351_10610
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     CD351_10610
Lipid biosynthesis proteins [BR:erk01004]
 Fatty acid synthase
  Component type
   CD351_10610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: AWW74875
UniProt: A0A2Z4K1T8
LinkDB All DBs
Position
complement(2243396..2244184)
Genome map
AA seq 262 aa AA seqDB search
MGVLDGKRGLVMGVANDRSIAWGIAKACADAGAELAFTYQGEAFGKRLAPLALSVGSDTM
LDVDVTDDASLDAAFGALRDKWDTLDFLVHAVAYSDKSELTGRILDTTRANFKNSMDISA
YSFIEVARRAHPMMKDNGGTLLTLSYMGSNRVTPNYNVMGVAKAALEAGVRYLANDLGPE
GIRVNAISPGPMKTLAGSAIGGARKTYKHTEANAPLRANATLDAVGGTAVYLCSDAGACT
TGEIIRVDGGFHVLGMPQHDNL
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgggcgttcttgacggaaaacgcggccttgtgatgggtgtggccaacgatcgctcgatc
gcatggggcatcgcgaaagcctgcgccgacgcaggtgccgagctggcctttacctatcag
ggcgaagcttttggaaagcggcttgcaccactggcgctgagcgttggttcggacaccatg
ctcgacgtcgacgtcacagatgacgcatcgctcgacgcggcctttggcgcgctgcgcgac
aagtgggacacgctcgattttctggttcacgctgtcgcctattcggacaagtccgaactg
accgggcgtattctcgataccacccgtgcgaacttcaagaactcgatggatatctcggcc
tacagcttcatcgaggtcgcacgccgcgcgcatccgatgatgaaggataatggcggcacg
cttctgacgctcagctatatgggttcgaaccgtgtcacgccgaactacaacgtcatgggc
gttgccaaggcggcgctggaggcgggtgtgcgataccttgccaacgacctcggccccgaa
ggcattcgcgtgaacgccatcagtccggggccgatgaagacgcttgcagggtcggccatt
ggcggcgctcgcaaaacctacaagcacaccgaagccaacgccccattgcgcgccaatgcg
acgcttgacgcggtgggaggcacggcggtctatctgtgctcggatgcgggcgcgtgcaca
accggcgagatcatccgcgtcgatggcggcttccacgttctcggcatgccccagcacgac
aatctgtga

DBGET integrated database retrieval system