KEGG   Erythrobacter sp. KY5: CD351_15545Help
Entry
CD351_15545       CDS       T05511                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
erk  Erythrobacter sp. KY5
Brite
KEGG Orthology (KO) [BR:erk00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CD351_15545
Enzymes [BR:erk01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CD351_15545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 FAD_oxidored HI0933_like AlaDh_PNT_C DAO NAD_binding_8 FAD_binding_3 FMO-like PE K_oxygenase Trp_halogenase
Motif
Other DBs
NCBI-ProteinID: AWW75843
UniProt: A0A2Z4K425
LinkDB All DBs
Position
3291153..3292742
Genome map
AA seq 529 aa AA seqDB search
MLDANMQTQLKQYLANLREPIELVASLGDDEKSAQTRELLSEIAELHEMVTASFDGTHER
KPSFIIRRASDANKWVRFAGLPMGHEFTSLVLALLWAGGHPPKVDADLIEQVRALEGDYE
FEMFFSLSCHNCPDVVQALTLMALENTHITATLIEGGTFQDEVEERGVLAVPATFLNGES
FFNGKMELAEILSKLDSGADAKAAEKLSAKDPFEVLVIGGGPAGAASAIYTARKGFRTGI
AAERFGGQLQDTLGIENLPGTSYTEGPKLSDDLKKQVAENEIDMMDLARATELKPATEAG
GMHEVTLANGAVLKSRSLILSTGARWRNLGVPGEAEYRNKGVAYCPHCDGPLFKGKRIAV
IGGGNSGVEAAIDLAKIVGHVTLIEFDKNLRADEVLQRKLRSMDNVEIITSGQTTEIIGD
GSRVSGLVLKDRTSGDERRIELEGVFVQIGLVPNTEWLADTGLELSKFGEIVVDDHGATN
LPGIYAAGDATTVKDKQIVVAMGTGATAGLGAFDYLIRNEPIDEIAQAA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgcaaacatgcagacccagctcaagcaatatctcgccaatcttcgcgagccg
atcgaactcgtcgcttcactgggcgacgatgaaaagtccgcgcagacccgcgaattgttg
agcgaaattgccgaattgcacgagatggtcaccgcctcgttcgatggcacgcatgaaagg
aagcccagcttcatcattcgccgtgcatcggatgcgaacaagtgggtacgctttgccggc
cttccgatgggccacgaatttacttcgctggtgctcgcgctgctgtgggcgggtggacat
ccgcccaaagttgacgccgaccttatcgaacaggttcgcgcgctcgaaggcgattatgag
ttcgagatgttcttctcgctttcctgccacaactgccccgacgtggtgcaggcgctgact
ctgatggcgctcgaaaacacgcatatcaccgccaccctgatcgagggcggcacctttcag
gatgaagtcgaggaacgcggcgtgctcgcggttcccgcgacgttccttaacggcgaaagc
tttttcaacggtaagatggagctcgccgaaatcctgtcgaagctcgacagcggcgccgac
gccaaggcagccgagaagctttcggcgaaagacccgttcgaagtgctggtaatcggcggc
gggcccgcaggtgcggcttcggcgatctacactgcacgcaagggtttccgcaccggcatc
gcggctgaacgcttcggcggacagcttcaggacactctcggcatcgaaaacctgccgggc
acctcctacaccgaagggcccaagctttctgacgatctgaagaaacaggtagccgagaac
gagatcgacatgatggacctcgcccgcgcaaccgagctcaagcccgctaccgaagcaggc
ggcatgcacgaagtgacgctggcaaacggcgcagtgctcaaatcgcgcagcctcatcctt
tcgaccggcgcacgttggcgcaaccttggcgttccgggcgaagccgaatatcgcaacaaa
ggcgtggcctactgcccgcactgtgacggcccgcttttcaagggcaagcgcatcgcggta
attggcggcggcaattcgggcgttgaggcagcgatcgacctcgccaagatcgtcggccat
gtgacgctgatcgaattcgacaagaacctgcgcgccgacgaagtgctgcaacgcaagctg
cgcagcatggataatgtcgagatcatcaccagcggccagacgaccgaaatcatcggcgat
ggaagccgggtatcgggcctcgtgctcaaagaccgcacaagcggcgacgaacgcaggatc
gaactcgaaggcgtgttcgtacagatcggccttgtgcccaacaccgaatggttggcggat
acgggtctcgaactgtcgaaattcggcgagattgtcgtcgatgaccacggcgcgaccaac
ctgcccggcatttatgcagcaggcgacgcgaccacggtgaaggacaagcagatcgtcgtc
gcgatgggcaccggcgcaaccgcaggtctgggcgcgttcgactacctcatccgcaacgag
ccaatcgacgaaatcgcccaggctgcgtga

DBGET integrated database retrieval system