KEGG   Enterobacter roggenkampii: BFV67_05635Help
Entry
BFV67_05635       CDS       T05556                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ern  Enterobacter roggenkampii
Brite
KEGG Orthology (KO) [BR:ern00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BFV67_05635
Enzymes [BR:ern01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BFV67_05635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 NAD_binding_8 FAD_oxidored HI0933_like FAD_binding_3 Thi4 K_oxygenase Glutaredoxin AlaDh_PNT_C FMO-like DAO
Motif
Other DBs
NCBI-ProteinID: AOP94687
UniProt: A0A384H8C0
LinkDB All DBs
Position
1224723..1226288
Genome map
AA seq 521 aa AA seqDB search
MLDTTMKTQLKAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSPKVTFKEDNSLNV
RKPSFLITNPGSELGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQALLEQIRDIDGDFE
FETYYSLSCHNCPDVVQALNLMSVLNPRIKHTAIDGGTFQNEITDRNVMGVPAVYLNGQE
FGQGRMTLTEIVAKVDTGAEKRAAEALNKRDAYDVLIVGSGPAGAAAAVYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVSDYDVDVIDSQSASRLVPAAVEG
GLHQIETASGAVLKARSIIIATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAPDMKADQVLQDKVRSLKNVDIVLNAQTTEVKGD
GSKVTGLEYRDRVSGDVHSVQLSGIFVQIGLLPNTTWLEGAIERNRMGEIIIDAKCETSV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTKTA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacaccacgatgaaaacccagctcaaggcctatcttgagaaactgaccaaaccc
gttgagctgattgccacgctggacgacagcgcgaaatcggcagagatcaaggaactgctg
gcagagattgctgaactgtcaccaaaagtgaccttcaaagaggataactcgcttaacgtc
cgtaagccgtctttcctgatcactaacccaggctctgagctggggccgcgttttgccggc
tcgccgctggggcacgaatttacctcgctggtgctggcgctgctgtggaccggcggtcat
ccgtcgaaagaggcgcaggcgctgctggagcagatccgcgatatcgacggtgattttgag
tttgaaacctattactcgctctcctgccacaactgtcctgacgtggtgcaggcgctgaac
ctgatgtcggtcctcaacccgcgcatcaaacacacggcaattgatggcggtaccttccag
aatgaaatcaccgatcgcaacgtgatgggcgttccggcggtgtatctgaacggtcaggaa
ttcggccagggccgtatgacgctgacggaaatcgtcgccaaagtggataccggtgcagaa
aaacgtgccgcagaagcgctgaacaaacgtgatgcctatgacgtgctgattgtcggttcc
ggccctgcgggtgcggcggcggcagtgtactccgcacgtaaagggatccgtaccggcctg
atgggcgaacgttttggtggccaggtgctggataccgtggacattgaaaactatatctcc
gtgccaaaaaccgaaggccagaagctggccggcgcgctgaaggcgcacgtcagcgattac
gacgtagatgtgatcgacagccagagcgccagcaggctggtacctgctgcggttgagggg
gggttacaccagattgaaaccgcctccggcgcggtgctgaaagcgcgcagcatcatcatt
gccaccggtgcgaaatggcgcaacatgaacgtcccgggcgaagatcagtatcgcaccaaa
ggcgtgacctactgcccgcactgcgacggcccgctgtttaaaggtaagcgcgtggcggtg
atcggcggcggtaactccggcgtggaagcggcgatcgacctggcggggattgttgaacac
gtaaccctgctggagttcgcgccagacatgaaggccgaccaggttctgcaggataaagtg
cgcagcctgaaaaacgtcgacatcgtgctgaacgcgcagaccacggaagtgaagggcgac
ggcagcaaggtcactggtctggaataccgcgaccgcgtgagcggcgacgtgcacagcgtg
cagctttcagggatcttcgtgcagattggtctgctgccaaacaccacctggctggaaggg
gcgattgagcgcaaccgcatgggcgaaatcatcatcgatgccaagtgtgaaaccagcgtg
aaaggcgtgtttgcggccggcgactgcaccaccgtgccgtacaaacagattattatcgcc
acgggcgaaggggcgaaggcgtctctgagcgcgtttgactacctgatccgcaccaaaacc
gcataa

DBGET integrated database retrieval system