KEGG   Enterobacter roggenkampii: BFV67_10930
Entry
BFV67_10930       CDS       T05556                                 

Definition
(GenBank) response regulator
  KO
K07315  phosphoserine phosphatase RsbU/P [EC:3.1.3.3]
Organism
ern  Enterobacter roggenkampii
Brite
KEGG Orthology (KO) [BR:ern00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ern03021]
    BFV67_10930
Enzymes [BR:ern01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.3  phosphoserine phosphatase
     BFV67_10930
Transcription machinery [BR:ern03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     BFV67_10930
SSDB
Motif
Pfam: SpoIIE Response_reg
Other DBs
NCBI-ProteinID: AOP95678
LinkDB
Position
complement(2327779..2328993)
AA seq 404 aa
MSALHVLIVEDSLIYRRLLSRMLTQWGYIVSEAENGVAALEILSSQPISMVISDWDMPEM
DGLTLCQTIRNRQFGHYVYVILLTARENAGDLTQGFDAGADDFLSKPVEQDELRARLHAG
VRILTLEATLAAHNKRLSEALHQIEQDLELAARVQHSVLPSHRLRFGNYFSDWLFMPSAW
VSGDVFNIFPLDSHIGFYCVDVSGHGVGAAMMSLAVARQFLHGRVVDRFLFTDQGGIQSP
AEVIGILNSRFCSEESDITSYFTIIYGVIDPESGRGVLCQAGHPTPVIVNADSAVTSVGN
GGPPVGLMPDLSWEDVAFTLNPGDRLCLFSDGITECENVSGEQFGPQRLERWLHDHARLP
VDQLLARFGDHLTGWRNANRDEPTALTDDVSLLVIERQGEQNDY
NT seq 1215 nt   +upstreamnt  +downstreamnt
atgtcggcgctgcacgtgttaatcgttgaagattcgctgatttatcgtcggttactctcc
cgaatgctcacccagtgggggtatatcgtgagcgaggctgaaaatggcgtcgccgcgctg
gaaatactgtccagccagccgatcagcatggtgataagcgactgggacatgccggaaatg
gacggactcacgctctgtcagaccatccgcaaccgtcagtttggccactacgtctatgtc
attctgctcacggcacgcgaaaatgccggggatttaacgcagggctttgatgccggagcc
gatgattttttaagcaagccggtcgaacaggatgaactgcgggcgcgtctgcacgccggg
gtccgtattttaacgctggaagcgaccctcgcggcgcacaacaagcgcctgagtgaagcg
ttgcatcagattgaacaggatcttgaactcgcggcgcgcgttcagcactccgtgctgcct
tcgcaccgcttacgctttgggaactacttttccgactggcttttcatgccgtctgcgtgg
gtctcaggcgatgtgttcaatatttttccactcgattctcacattgggttctattgcgtg
gatgtgtccggtcacggcgtgggggccgcgatgatgtccctcgcggtggcgcgtcagttc
ttacatggccgggtggtagaccgttttttgtttaccgatcagggcggcattcagtcgcct
gcggaggtgatcggaatcctgaacagccgcttttgcagtgaagagagcgacattaccagc
tatttcaccattatctacggggtgatcgaccccgagagcggacgaggggtgttgtgtcag
gccgggcatcctactcccgtcattgtgaacgcagacagcgccgtcacgtccgtgggcaat
ggcggcccgccggtcgggctgatgcctgacctcagctgggaggacgtcgcgtttaccctc
aatccgggggatcgcttatgcttattcagtgacggtattacggagtgtgagaacgtcagc
ggcgagcagtttggcccgcagcgtctcgaacgctggcttcatgaccatgcccgacttccg
gttgaccagctcctggcgcggttcggtgaccacctgaccggctggcgcaatgcaaatcgt
gatgaaccgaccgccttaaccgatgacgtttcactgctcgtgatcgagcgtcagggagaa
cagaatgattattaa

DBGET integrated database retrieval system