KEGG   Enterobacter roggenkampii: BFV67_13705Help
Entry
BFV67_13705       CDS       T05556                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
ern  Enterobacter roggenkampii
Pathway
ern00500  Starch and sucrose metabolism
ern01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ern00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BFV67_13705
Enzymes [BR:ern01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     BFV67_13705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 Alpha-amylase_C DUF1939 CdhD
Motif
Other DBs
NCBI-ProteinID: AOP97868
LinkDB All DBs
Position
2907676..2909163
Genome map
AA seq 495 aa AA seqDB search
MKNPTLLQCFHWYYPAGGELWREVTALAPNLNEIGINMIWLPPAYKGASGGYSVGYDSYD
LFDLGEFDQKGSIATKYGDKAQLLEAIDALKRNDIAVLLDVVVNHKMGADEKESVRVQRV
NEQDRTQIDDEVIECEAWTRYTFPARAGQYSQFIWDYKCFSGVDHIENPDEDGIFKIVND
YTGEGWNDQVDDEMGNFDYLMGENIDFRNHAVTEEIKYWARWVMEQTRCDGFRLDAVKHI
PAWFYKEWIEHVQEVADQPLFIVAEYWSHEVDKLQAYIDQVEGKTMLFDAPLQMKFHEAS
RQGRDYDMSQIFTGTLVEADPFHAVTLVANHDTQPLQALEAPVEAWFKPLAYALILLREN
GVPSVFYPDLFGASYDDTGGDGETYHIDMPVIEQLHELILARQRFAHGVQTLFFDHPNCI
AFSRSGTEDDPGCVVVMSNGDDGEKVICLGENYGNKTWRDFLGNREETVTTAADGEGTFT
CKGGSVSVWVIEDAL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaccccaccctgttacaatgttttcactggtactaccctgctggcggtgaattg
tggcgagaggtcacggcgttagcccccaatcttaacgaaatcggcattaacatgatctgg
ctcccgcccgcctataaaggcgcgtcaggcggatattctgtcggctatgactcctatgac
ctgttcgatctgggcgagtttgaccagaaaggcagtatcgccacgaaatacggtgacaaa
gcgcagctgctggaagccatcgacgccctcaagcgcaacgacattgccgtgctgctggac
gtagtggtcaaccacaaaatgggggcagatgagaaagagtctgtgcgcgttcagcgcgtg
aacgagcaggatcgcacgcagatcgacgatgaggtcatcgagtgcgaagcctggacccgc
tacaccttccctgcccgcgccgggcaatattcccagtttatctgggactacaaatgcttc
agcggcgtcgaccacattgaaaaccccgatgaagacggcatttttaaaatcgtcaacgac
tacaccggcgaaggctggaacgatcaggttgatgatgagatgggtaacttcgactatctg
atgggtgaaaatatcgactttcgcaatcacgccgtcaccgaggagatcaaatactgggcc
cgctgggtcatggaacagacgcgctgcgacggttttcgtctggacgccgtcaagcatatt
cccgcctggttctacaaagagtggattgagcacgtccaggaggtcgccgaccagccgctg
tttatcgtggcggaatactggtctcacgaggtggataaacttcaggcctatatcgaccag
gtcgaaggcaaaaccatgctgtttgatgcccccctgcagatgaaattccacgaggcgtca
cgtcagggccgggattacgacatgagccaaatctttaccggcacgctggtggaagccgat
ccgtttcatgcggtcaccctcgtcgcaaaccatgacacccagcctttgcaggcgctggaa
gccccggtcgaagcctggtttaaaccgctggcgtatgcgctgatcctgctgcgggaaaat
ggcgtgccgagcgtcttttaccctgacctctttggcgccagctatgacgatacgggtgga
gatggagagacgtaccatattgatatgccggtcattgagcagctccacgagctgatcctc
gcgcgccagcgttttgcccacggcgtgcagacgctcttttttgaccatcctaactgcatc
gccttcagccgcagcggcacggaagacgatcccggctgcgtggtggtgatgtcgaacggg
gacgacggcgagaaggtaatttgcctgggggaaaactacggcaacaaaacgtggcgtgat
tttctcggcaatcgcgaagaaacggtcaccacggcggcagatggcgaagggacgtttacc
tgcaaaggcggaagcgtgagcgtgtgggtaattgaggatgcgctgtag

DBGET integrated database retrieval system