KEGG   Encephalitozoon romaleae: EROM_041110Help
Entry
EROM_041110       CDS       T03458                                 

Definition
(RefSeq) KTR mannosyltransferase
  KO
K10967  alpha 1,2-mannosyltransferase [EC:2.4.1.-]
Organism
ero  Encephalitozoon romaleae
Pathway
ero00514  Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ero00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    EROM_041110
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ero01003]
    EROM_041110
Enzymes [BR:ero01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     EROM_041110
Glycosyltransferases [BR:ero01003]
 Glycan extension
  Yeast mannan chain
   EROM_041110
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_15
Motif
Other DBs
NCBI-GeneID: 20521175
NCBI-ProteinID: XP_009264375
UniProt: I6ZI30
LinkDB All DBs
Position
IV
AA seq 322 aa AA seqDB search
MLLLLVIIGMGICKENAVILILCRNSDKNGITETIKNFEEMFNKNFGYPYVFLNDEEFTE
DFKKSIKGITSSSVEFGKLDPEEWEVPPWIDMEKAKQGMKNLEERKIIYGGSLSYRKMCR
FFSGFFYKNKLVQKYDYYWRIEPDVKFLCQIEYDPFTYLRENNKQYGFVISLVEFMETIP
SLFGEAIKFATKNLNLIKKANGNRFILNKDGSYNGCHFWSNFEIANFGFFRSETYQKYFD
WLDRAGGFFYERWGDAPVHSIAASLFLDKDEIHFFSDIGYEHPPFRHCPREASMKSKCKC
SITDSMDISSNTCLGMYIKSLL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgcttctgcttcttgtgattattggaatggggatttgcaaggaaaatgctgtaatcctg
attctttgtaggaacagtgacaagaacggaataacagaaacgataaagaactttgaggag
atgtttaacaaaaactttgggtatccgtacgtgttcctgaatgacgaggagtttaccgaa
gacttcaagaaatccataaagggcattacatctagcagtgttgaatttggaaagcttgat
cctgaagaatgggaggttccaccatggatagatatggaaaaagcaaaacaaggaatgaag
aacttggaagaaagaaagattatttatggagggtctctgtcatataggaagatgtgtaga
ttcttttcagggttcttttataagaacaagctggttcagaagtatgactattattggagg
atagaaccagatgtgaagtttctatgccagatagagtacgacccatttacatatctgagg
gaaaacaacaaacaatatggatttgtgatatctcttgtcgagttcatggagacgattcct
agcctttttggagaagcgataaaatttgcaacaaagaatctaaatctaataaagaaggcc
aatggaaatagattcatactgaacaaggacggatcgtataacggatgtcacttctggtcg
aattttgagatagcaaactttggttttttcagaagtgagacatatcaaaagtattttgat
tggttagatagagctggaggctttttctatgagaggtggggagatgcgcctgtgcatagc
attgcagcatctctttttttggataaggacgagatccattttttcagtgatataggatac
gagcaccctccgttccgccactgcccaagggaggcatcgatgaaatcgaagtgcaagtgc
agcatcacggattcgatggatatatcttcgaacacatgcctggggatgtacataaaatct
cttttgtga

DBGET integrated database retrieval system