KEGG   Erythrobacter sp. YH-07: DVR09_02970Help
Entry
DVR09_02970       CDS       T05587                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase FabI
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
err  Erythrobacter sp. YH-07
Pathway
err00061  Fatty acid biosynthesis
err00780  Biotin metabolism
err01100  Metabolic pathways
err01130  Biosynthesis of antibiotics
err01212  Fatty acid metabolism
Module
err_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:err00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    DVR09_02970
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    DVR09_02970
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    DVR09_02970
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:err01004]
    DVR09_02970
Enzymes [BR:err01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     DVR09_02970
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     DVR09_02970
Lipid biosynthesis proteins [BR:err01004]
 Fatty acid synthase
  Component type
   DVR09_02970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: AXK41428
UniProt: A0A345YBX6
LinkDB All DBs
Position
complement(594833..595642)
Genome map
AA seq 269 aa AA seqDB search
MSGLMAGKRGLIMGLANDKSLAWGIAQQLARHGAELAFSYQGEALKKRVGPLAEKLGSDF
LIECDVSDMAALDTAFDTLKQRWETIDFVVHAIGFSDKNELRGKYVDTSLDNFLMTMNIS
AYSLVAVAQRAATMMPHGGSILTLTYYGAEKVIPHYNVMGVAKAALETSVKYLANDLGPQ
NIRVNALSAGPVKTLAASGIGDFRYILKWNELNSPLRRNITIDDVGGSGLYLLSDLSSGV
TGETHHVDAGYHVVGMKQEDAPDIALDKG
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggttgatggcaggaaagcgcgggctgatcatggggctcgccaatgacaagtct
ctggcctggggcatcgcgcagcagcttgcccggcacggggcggaactggcgttctcctat
cagggcgaagcgctcaagaagcgcgtcgggccattggcggaaaagctcgggagcgatttc
ctgatcgaatgcgacgtgtccgatatggcggcactcgataccgccttcgacacgctcaaa
cagcgctgggagacgatcgatttcgtcgtccacgccatcggcttttcggacaagaacgag
ctacgcgggaaatatgtcgataccagcctcgacaatttcctgatgacgatgaacatttcc
gcctattcgctggtcgcggtggcgcagcgggcggcgaccatgatgccccatggcggatcg
atcctgaccttgacctattacggcgcggaaaaggtcattccgcattacaacgtgatgggt
gtggccaaggctgcgctggaaaccagcgtgaaatatctcgccaacgaccttgggccgcag
aatatccgcgtcaatgcgctgagcgcgggtccggtcaagaccttggccgcgagcggcatc
ggcgatttccgctatattctgaaatggaacgagcttaattcgcccctgcggcggaatatc
acgatcgacgatgtcggcgggtcgggcctgtatctcctgtccgacctgtcatcgggcgtg
accggcgagacgcaccatgtcgatgcgggctatcatgttgtcggcatgaagcaggaagac
gcgccggatatcgcgttggacaagggctga

DBGET integrated database retrieval system